Comparing Echvi_3167 Echvi_3167 ribose-phosphate pyrophosphokinase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q58761 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
28% identity, 95% coverage: 4:286/297 of query aligns to 2:280/284 of Q58761
1u9zA Crystal structure of phosphoribosyl diphosphate synthase complexed with amp and ribose 5-phosphate (see paper)
27% identity, 95% coverage: 4:286/297 of query aligns to 2:270/274 of 1u9zA
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
32% identity, 81% coverage: 34:273/297 of query aligns to 32:271/291 of Q97Z86
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
31% identity, 81% coverage: 34:273/297 of query aligns to 32:258/278 of 4twbA
Q97CA5 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) (see paper)
27% identity, 89% coverage: 5:269/297 of query aligns to 3:261/286 of Q97CA5
3lpnA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). (see paper)
27% identity, 89% coverage: 5:269/297 of query aligns to 3:261/284 of 3lpnA
3mbiD Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
27% identity, 89% coverage: 5:269/297 of query aligns to 3:261/285 of 3mbiD
3mbiA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
27% identity, 89% coverage: 5:269/297 of query aligns to 5:263/287 of 3mbiA
2hcrA Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 in complex with amp(atp), cadmium and sulfate ion (see paper)
27% identity, 97% coverage: 5:292/297 of query aligns to 4:294/305 of 2hcrA
P60891 Ribose-phosphate pyrophosphokinase 1; PPRibP; Phosphoribosyl pyrophosphate synthase I; PRS-I; EC 2.7.6.1 from Homo sapiens (Human) (see 5 papers)
27% identity, 97% coverage: 5:292/297 of query aligns to 6:302/318 of P60891
Sites not aligning to the query:
8dbkB Human prps1 with phosphate, atp, and r5p; hexamer with resolved catalytic loops (see paper)
27% identity, 97% coverage: 5:292/297 of query aligns to 5:301/316 of 8dbkB
8dbeA Human prps1 with adp; hexamer (see paper)
27% identity, 97% coverage: 5:292/297 of query aligns to 5:301/316 of 8dbeA
Sites not aligning to the query:
7yk1A Structural basis of human prps2 filaments (see paper)
26% identity, 97% coverage: 4:292/297 of query aligns to 4:292/306 of 7yk1A
Sites not aligning to the query:
8dbgA Human prps1 with phosphate and atp; hexamer (see paper)
27% identity, 97% coverage: 5:292/297 of query aligns to 5:294/309 of 8dbgA
7pn0A Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus at r32 space group
26% identity, 95% coverage: 4:285/297 of query aligns to 4:284/312 of 7pn0A
5t3oA Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus (see paper)
26% identity, 95% coverage: 4:285/297 of query aligns to 3:283/307 of 5t3oA
O94413 Ribose-phosphate pyrophosphokinase 2; Phosphoribosyl pyrophosphate synthase 2; EC 2.7.6.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 98% coverage: 5:295/297 of query aligns to 8:308/321 of O94413
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
23% identity, 98% coverage: 5:296/297 of query aligns to 6:306/315 of P0A717
Sites not aligning to the query:
4s2uA Crystal structure of the phosphorybosylpyrophosphate synthetase from e. Coli
23% identity, 98% coverage: 5:296/297 of query aligns to 5:305/308 of 4s2uA
6asvC E. Coli prpp synthetase (see paper)
23% identity, 98% coverage: 5:296/297 of query aligns to 4:304/311 of 6asvC
>Echvi_3167 Echvi_3167 ribose-phosphate pyrophosphokinase
MKTILFSLPGNEKLTELMATKMDAEVGKATLRNFPDGESYTRILSDVKDKCVVLVCTLHE
PDEKLLPLYFLSHTAKSLGAMCTCLVAPYLAYMRQDKVFNEGEGVTSGFFGKLISGFADS
ITTVDPHLHRISSLGEVYQIPNKVIHAADAISDWIKENIENPVLIGPDSESEQWVSEVAK
NAGAPFIVLQKMRHGDRDVEVSVPDVDIYKDATPILVDDIISTARTMIETVQHLKKAGMK
PPICVGIHAVFSGNSYKDLLGSGVEKIVTCNTIPHPSNGIDLSDIMAKEVKKLMHQI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory