Comparing Echvi_3284 FitnessBrowser__Cola:Echvi_3284 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
37% identity, 73% coverage: 5:301/408 of query aligns to 7:303/402 of 4pg7A
Sites not aligning to the query:
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
36% identity, 59% coverage: 61:301/408 of query aligns to 73:313/435 of Q5F8J4
Sites not aligning to the query:
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
35% identity, 64% coverage: 61:323/408 of query aligns to 73:334/431 of 6dzsA
Sites not aligning to the query:
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
28% identity, 72% coverage: 7:301/408 of query aligns to 5:292/300 of 7f4cA
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
26% identity, 75% coverage: 1:304/408 of query aligns to 1:311/319 of 4xb1A
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
26% identity, 75% coverage: 1:304/408 of query aligns to 1:311/319 of 4xb2A
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
29% identity, 75% coverage: 4:307/408 of query aligns to 5:308/332 of 6a0tB
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
27% identity, 72% coverage: 7:301/408 of query aligns to 5:294/302 of 5x9dA
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
29% identity, 75% coverage: 4:307/408 of query aligns to 5:308/331 of 6a0sA
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
29% identity, 75% coverage: 4:307/408 of query aligns to 5:308/331 of 2ejwA
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
28% identity, 45% coverage: 34:217/408 of query aligns to 53:238/319 of 3ingA
Sites not aligning to the query:
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
39% identity, 27% coverage: 87:197/408 of query aligns to 118:236/376 of O94671
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 34% coverage: 59:197/408 of query aligns to 641:781/916 of O81852
Sites not aligning to the query:
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 30% coverage: 76:196/408 of query aligns to 101:227/359 of P31116
Sites not aligning to the query:
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
33% identity, 30% coverage: 76:196/408 of query aligns to 100:226/358 of 1tveA
Sites not aligning to the query:
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
33% identity, 30% coverage: 76:196/408 of query aligns to 100:226/358 of 1q7gA
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
33% identity, 30% coverage: 76:196/408 of query aligns to 100:226/358 of 1ebuD
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
33% identity, 30% coverage: 76:196/408 of query aligns to 100:226/358 of 1ebfA
Sites not aligning to the query:
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
33% identity, 30% coverage: 81:202/408 of query aligns to 108:226/321 of 3jsaA
Sites not aligning to the query:
>Echvi_3284 FitnessBrowser__Cola:Echvi_3284
MTNRIGLFGFGVVGQGYYEIAKNDRPSLLPETIVVQNKNKERPHSLQLSFDPKDILNTPH
DIGIELISDPIQAYDYVSSLLKSGKKVISANKKMLAAHLPELLELEKSYGGSLLYEASAA
AGIPIITCLDCHFAGDHISKLQGILNGSSNYILSRLFQDDLSLSDAVKLAQEKGFAEADP
TLDINGSDVSSKLTILSLHAFGRYIPENEILTIGVQHVHAEDVALAKSLGLKIKLIATVQ
RSQDGLSMYILPALVGESDPLFLVENEYNAAKVTSHNLGEQFFQGKGAGSLPTGASVYAD
LTKAIKGYAYSYDKLQGAKIKREKPLTASLEVIVSADTADALAPLIGQATIHQAQERYWS
ICTLATEDLIKHLPAIEANNVSIIALNGSVRQERILDSIQKLENVHLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory