Comparing Echvi_3304 FitnessBrowser__Cola:Echvi_3304 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
52% identity, 95% coverage: 1:272/287 of query aligns to 11:281/281 of 6aa8E
Sites not aligning to the query:
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
51% identity, 95% coverage: 1:272/287 of query aligns to 12:282/282 of 4kugA
Sites not aligning to the query:
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
51% identity, 94% coverage: 1:270/287 of query aligns to 12:280/280 of 4kuhA
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
51% identity, 95% coverage: 1:272/287 of query aligns to 13:283/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
51% identity, 95% coverage: 1:272/287 of query aligns to 13:283/283 of 4pzdA
Sites not aligning to the query:
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
42% identity, 94% coverage: 1:270/287 of query aligns to 15:290/293 of 1f17A
Sites not aligning to the query:
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
42% identity, 94% coverage: 1:270/287 of query aligns to 15:290/293 of 1f12A
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
42% identity, 94% coverage: 1:270/287 of query aligns to 38:313/314 of Q16836
Sites not aligning to the query:
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
42% identity, 94% coverage: 1:270/287 of query aligns to 15:290/291 of 1f0yA
Sites not aligning to the query:
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
40% identity, 94% coverage: 1:270/287 of query aligns to 38:313/314 of P00348
Sites not aligning to the query:
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 94% coverage: 1:270/287 of query aligns to 16:286/286 of P9WNP7
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
36% identity, 96% coverage: 1:276/287 of query aligns to 372:645/763 of P40939
Sites not aligning to the query:
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
37% identity, 96% coverage: 1:275/287 of query aligns to 351:627/735 of 8oqsB
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
37% identity, 96% coverage: 1:275/287 of query aligns to 339:615/723 of 8oqqA
Sites not aligning to the query:
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
37% identity, 96% coverage: 1:275/287 of query aligns to 339:615/723 of 8oqpA
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
37% identity, 96% coverage: 1:275/287 of query aligns to 327:603/711 of 7o4uA
Sites not aligning to the query:
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
37% identity, 96% coverage: 1:275/287 of query aligns to 347:623/731 of 4b3iA
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
37% identity, 96% coverage: 1:275/287 of query aligns to 343:619/726 of 8oqvA
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
37% identity, 96% coverage: 1:275/287 of query aligns to 345:621/728 of 8oqrA
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
37% identity, 96% coverage: 1:275/287 of query aligns to 344:620/728 of 8oqlA
Sites not aligning to the query:
>Echvi_3304 FitnessBrowser__Cola:Echvi_3304
MGNGIAHVFAQHDHQVSLIDKDEKALEKGLATIAKNLDRQIEKGIIQAETKDSTLANITP
YSDMEKGVKNVAIVVEAATENTELKLEIFRQLDQFSPKEAILATNTSSISITKIAAATSR
PDKVIGMHFMNPVPVMQLVEVIKGYKTSEETTHQVMSVAKALEKAPVAVNDYPGFVANRI
LMPMINEAIYALYEGVSGVQEIDTVMKLGMAHPMGPLQLADFIGLDVCHAILDVLYQGLG
NPKYAPCPLLVNMVEAGNKGVKSGEGFYIYSQGSKELVVSERFQKQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory