Comparing Echvi_3321 FitnessBrowser__Cola:Echvi_3321 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t99A Crystal structure of bugh2awt in complex with galactoisofagomine (see paper)
44% identity, 96% coverage: 31:817/820 of query aligns to 10:753/757 of 5t99A
7cwdA Crystal structure of beta-galactosidase ii from bacillus circulans in complex with beta-d-galactopyranosyl disaccharide (see paper)
39% identity, 96% coverage: 31:817/820 of query aligns to 6:799/803 of 7cwdA
4cu8A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa (see paper)
35% identity, 96% coverage: 31:817/820 of query aligns to 18:842/848 of 4cu8A
4cu7A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa (see paper)
35% identity, 96% coverage: 31:817/820 of query aligns to 18:842/848 of 4cu7A
4cucA Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa. (see paper)
35% identity, 96% coverage: 31:817/820 of query aligns to 18:842/847 of 4cucA
6qubA Truncated beta-galactosidase iii from bifidobacterium bifidum in complex with galactose
32% identity, 95% coverage: 34:812/820 of query aligns to 15:846/857 of 6qubA
7nitD X-ray structure of a multidomain bbgiii from bifidobacterium bifidum (see paper)
32% identity, 95% coverage: 34:812/820 of query aligns to 33:864/1253 of 7nitD
Sites not aligning to the query:
5dmyA Beta-galactosidase - construct 33-930
31% identity, 95% coverage: 34:812/820 of query aligns to 17:844/855 of 5dmyA
6qudA 2-deoxy-galactose reaction intermediate of a truncated beta- galactosidase iii from bifidobacterium bifidum
32% identity, 95% coverage: 34:812/820 of query aligns to 15:826/837 of 6qudA
5t9gC Crystal structure of bugh2cwt in complex with galactoisofagomine (see paper)
30% identity, 96% coverage: 35:819/820 of query aligns to 7:810/811 of 5t9gC
6nzgA Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine (see paper)
28% identity, 78% coverage: 26:663/820 of query aligns to 2:634/837 of 6nzgA
6d50B Bacteroides uniforms beta-glucuronidase 2 bound to d-glucaro-1,5- lactone (see paper)
28% identity, 78% coverage: 26:663/820 of query aligns to 2:634/840 of 6d50B
6hpdA The structure of a beta-glucuronidase from glycoside hydrolase family 2 (see paper)
25% identity, 97% coverage: 26:819/820 of query aligns to 8:777/955 of 6hpdA
T2KN75 Beta-glucuronidase; Glycosyl hydrolase 2 family protein P17; P17_GH2; Polysaccharide utilization locus H protein P17; PUL H protein P17; EC 3.2.1.31 from Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) (see paper)
25% identity, 97% coverage: 26:819/820 of query aligns to 26:795/981 of T2KN75
8dhlB Tannerella forsythia beta-glucuronidase (l2) (see paper)
27% identity, 71% coverage: 35:616/820 of query aligns to 11:579/853 of 8dhlB
Sites not aligning to the query:
5z1aA The crystal structure of bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine
26% identity, 73% coverage: 103:700/820 of query aligns to 48:644/655 of 5z1aA
6d7jA The crystal structure of parabacteroides merdae beta-glucuronidase (gus) with glycerol in active-site (see paper)
26% identity, 87% coverage: 101:810/820 of query aligns to 66:789/799 of 6d7jA
8dhlA Tannerella forsythia beta-glucuronidase (l2) (see paper)
28% identity, 59% coverage: 35:520/820 of query aligns to 12:496/827 of 8dhlA
Sites not aligning to the query:
6mvgA Crystal structure of fmn-binding beta-glucuronidase from ruminococcus gnavus (see paper)
27% identity, 78% coverage: 26:663/820 of query aligns to 1:595/637 of 6mvgA
8gesA R. Hominis 2 beta-glucuronidase bound to unc10201652-glucuronide
25% identity, 78% coverage: 25:662/820 of query aligns to 1:598/644 of 8gesA
>Echvi_3321 FitnessBrowser__Cola:Echvi_3321
MRFRSILICLLLIGSICSFSHAQRVRKSWPLKEDWRFSKGEQEEAYQIDFDDREWESVQV
PHDWAIYGPFDESNDLQIVAVTQNGEKVATKKTGRTGGLPYMGVGWYRRAFEVPGFDPEK
QRVKLIFDGAMSEAQVYVNGEKVGFWPYGYNSFYFDVTDFLHADGTKNQLAVRLENKPQS
SRWYPGAGLYRNVHVLVTPKIHVPVWGTFVTTPYVSEEYASVNIKTELEHVSEGTDISIE
TSILDLSGKVVAKKKNVQRLNHGRPLEQFLTVDHPELWSPESPHLYVAKSVISIEGREID
EFTTRFGIRKIEFIADKGFFLNGQRRKFQGVNLHHDLGPLGAAVNRSAIKRQLQLMKDMG
ADAIRTSHNMPAPELVELCDEMGLMVMVESFDEWDVAKCKNGYHRFFDDWAEKDLVNMVR
HYRNHPSVVMWSIGNEVPTQCSADGYQVAKFLQDICHREDPTRLVTAGMDQISCVLDNGF
AAMIDVTGFNYRTHRYEEGYQKLPHSLVLGSETGSTVSSRGVYHFPVEKGAQVIHENQQS
SAYGLEYCSWSNLPEDDFALADDFDWTLGQFVWTGFDYLGEPTPYDTDAWPNHSSMFGIV
DLAGIPKDRYYLYKSVWKPEEETLHILPHWNWEGREGQKTPLFVYTNYPSAELFINGESQ
GKQTKHKEGTLQERYRLMWMDAIYEPGEVKVVAYDSLGKKAAEKILHTAGKPHHIELVPE
NKRIAVEGDELAFIRVQVVDKEGRVCPTDQRSLSFDVAGAGAFRAVANGDPGSLELFHEP
QMKVFNGQLTLIVSAKEAGNIHIKATAKGLKNGETIMEAY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory