Comparing Echvi_3348 FitnessBrowser__Cola:Echvi_3348 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
46% identity, 99% coverage: 3:399/400 of query aligns to 3:409/412 of 8w7fB
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
47% identity, 99% coverage: 3:399/400 of query aligns to 3:407/410 of 8w78A
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
30% identity, 77% coverage: 4:312/400 of query aligns to 4:313/366 of 3dmeA
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
27% identity, 70% coverage: 2:282/400 of query aligns to 3:286/384 of 4x9mA
Sites not aligning to the query:
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
27% identity, 70% coverage: 2:282/400 of query aligns to 3:286/384 of P75063
Sites not aligning to the query:
>Echvi_3348 FitnessBrowser__Cola:Echvi_3348
MTYDIAIVGGGIVGLATGLKIIQQRPELKVVILEKEHELAKHQTGNNSGVIHSGLYYKPG
SLKATNCISGYHELIQFCEEENIPFEITGKVVVATKDEQLPLLQNLLKRGLQNGLKGTRQ
ITLDELKEYEPYCKGVAALHVPQTGIVDYKKVALAYGEKFKSLGGEILLDHQVKKINHKA
NQTELITTGKTILSRLMINCAGLYSDKVADMNGELDLDVKIIPFRGEYYKLKKEREYLVK
NLIYPVPDPNFPFLGVHFTRMMKGGVEAGPNAVMAFKREGYKRTDFNLKEFRESITWPGL
QKVAAKYWKTGIGEYYRSFSKAAFTTALQELIPDIKEDDLVDGGAGVRAQACDRTGGLLD
DFAITENTHAINVLNAPSPAATSSLSIGGTVSARALKRFL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory