SitesBLAST
Comparing Echvi_3354 FitnessBrowser__Cola:Echvi_3354 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
35% identity, 88% coverage: 6:370/416 of query aligns to 3:372/494 of 1tdjA
- active site: K58 (= K53), A83 (= A78), E209 (= E208), S213 (≠ A212), C215 (≠ S214), G237 (= G236), L310 (≠ V308), S311 (= S309)
- binding pyridoxal-5'-phosphate: F57 (≠ Y52), K58 (= K53), N85 (= N80), G184 (= G183), G185 (= G184), G186 (= G185), G187 (= G186), G237 (= G236), E282 (= E281), S311 (= S309), G312 (= G310)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
35% identity, 88% coverage: 6:370/416 of query aligns to 7:376/514 of P04968
- K62 (= K53) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N80) binding
- GGGGL 188:192 (≠ GGGGM 183:187) binding
- S315 (= S309) binding
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
36% identity, 76% coverage: 4:321/416 of query aligns to 7:321/326 of 2gn2A
- active site: K56 (= K53), A81 (= A78), Q207 (≠ E208), V211 (≠ A212), G213 (≠ S214), G235 (= G236), I308 (≠ V308), S309 (= S309)
- binding cytidine-5'-monophosphate: R51 (≠ A48), T52 (≠ V49), G53 (≠ R50), A114 (≠ R111), D117 (≠ L114), Y118 (≠ F115), N312 (= N312)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
34% identity, 77% coverage: 1:321/416 of query aligns to 1:316/319 of A4F2N8
- K53 (= K53) mutation to A: Loss of enzymatic activity.
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 76% coverage: 5:320/416 of query aligns to 9:319/323 of O59791
- S82 (≠ A78) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
32% identity, 76% coverage: 5:320/416 of query aligns to 5:315/319 of 2zr8A
- active site: K53 (= K53), S78 (≠ A78), E204 (= E208), G208 (≠ A212), D210 (≠ S214), G232 (= G236), I303 (≠ V308), S304 (= S309)
- binding magnesium ion: E204 (= E208), G208 (≠ A212), D210 (≠ S214)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y52), K53 (= K53), S77 (= S77), S78 (≠ A78), N80 (= N80), H81 (= H81), P147 (= P150), G179 (= G183), G180 (= G184), G181 (= G185), G182 (= G186), G232 (= G236), E277 (= E281), T279 (≠ A283), S304 (= S309)
- binding serine: S78 (≠ A78), R129 (≠ A132), D231 (= D235), G232 (= G236), A233 (= A237), Q234 (≠ A238), T235 (≠ V239)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
32% identity, 76% coverage: 5:320/416 of query aligns to 5:315/319 of 2zpuA
- active site: K53 (= K53), S78 (≠ A78), E204 (= E208), G208 (≠ A212), D210 (≠ S214), G232 (= G236), I303 (≠ V308), S304 (= S309)
- binding magnesium ion: E204 (= E208), G208 (≠ A212), D210 (≠ S214)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y52), K53 (= K53), S77 (= S77), S78 (≠ A78), N80 (= N80), H81 (= H81), P147 (= P150), G179 (= G183), G180 (= G184), G181 (= G185), G182 (= G186), G232 (= G236), E277 (= E281), T279 (≠ A283), S304 (= S309)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
32% identity, 76% coverage: 5:320/416 of query aligns to 4:314/318 of 1wtcA
- active site: K52 (= K53), S77 (≠ A78), E203 (= E208), G207 (≠ A212), D209 (≠ S214), G231 (= G236), I302 (≠ V308), S303 (= S309)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ H21), K47 (≠ A48), M48 (≠ V49), A109 (≠ N110), A110 (≠ R111), Y114 (≠ F115)
- binding magnesium ion: E203 (= E208), G207 (≠ A212), D209 (≠ S214)
- binding pyridoxal-5'-phosphate: F51 (≠ Y52), K52 (= K53), N79 (= N80), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), G231 (= G236), E276 (= E281), T278 (≠ A283), S303 (= S309)
1v71A Crystal structure of s.Pombe serine racemase
32% identity, 76% coverage: 5:320/416 of query aligns to 4:314/318 of 1v71A
- active site: K52 (= K53), S77 (≠ A78), E203 (= E208), G207 (≠ A212), D209 (≠ S214), G231 (= G236), I302 (≠ V308), S303 (= S309)
- binding magnesium ion: E203 (= E208), G207 (≠ A212), D209 (≠ S214)
- binding pyridoxal-5'-phosphate: F51 (≠ Y52), K52 (= K53), N79 (= N80), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), G231 (= G236), E276 (= E281), T278 (≠ A283), S303 (= S309), G304 (= G310)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
33% identity, 75% coverage: 6:315/416 of query aligns to 21:329/339 of Q7XSN8
- E219 (= E208) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ S214) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
31% identity, 76% coverage: 4:318/416 of query aligns to 4:319/322 of 7nbgAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E208), A211 (= A212), D213 (≠ S214), G236 (= G236), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (≠ S214)
- binding pyridoxal-5'-phosphate: F52 (≠ Y52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (= M187), G236 (= G236), V237 (≠ A237), T282 (≠ A283), S310 (= S309), G311 (= G310)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A78), G85 (≠ A82), Q86 (= Q83), I101 (= I98), K111 (= K108), I115 (≠ M112), Y118 (≠ F115)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
31% identity, 76% coverage: 4:318/416 of query aligns to 4:319/320 of 7nbhAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E208), A211 (= A212), D213 (≠ S214), G236 (= G236), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (≠ S214)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A78), G85 (≠ A82), Q86 (= Q83), K111 (= K108), I115 (≠ M112), Y118 (≠ F115), D235 (= D235), P281 (= P282), N313 (= N312), V314 (≠ N313), D315 (= D314)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
31% identity, 76% coverage: 4:318/416 of query aligns to 4:319/323 of 7nbfAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E208), A211 (= A212), D213 (≠ S214), G236 (= G236), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (≠ S214)
- binding magnesium ion: N244 (≠ I245)
- binding pyridoxal-5'-phosphate: F52 (≠ Y52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (= M187), G236 (= G236), V237 (≠ A237), T282 (≠ A283), S310 (= S309), G311 (= G310)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (= H21), L22 (≠ P22), T23 (= T23), P24 (= P24), L26 (≠ Q26), T27 (≠ F27), F46 (≠ L46)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
31% identity, 76% coverage: 4:318/416 of query aligns to 4:319/323 of 7nbdAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E208), A211 (= A212), D213 (≠ S214), G236 (= G236), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (≠ S214)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ Y273), L278 (≠ V279), V314 (≠ N313), L316 (≠ I315)
- binding magnesium ion: N244 (≠ I245)
- binding pyridoxal-5'-phosphate: F52 (≠ Y52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (= M187), G236 (= G236), V237 (≠ A237), E280 (= E281), T282 (≠ A283), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
31% identity, 76% coverage: 4:318/416 of query aligns to 4:319/323 of 7nbcCCC
- active site: K53 (= K53), S81 (≠ A78), E207 (= E208), A211 (= A212), D213 (≠ S214), G236 (= G236), L309 (≠ V308), S310 (= S309)
- binding biphenyl-4-ylacetic acid: T78 (≠ C75), H79 (≠ A76), H84 (= H81), V148 (= V148), H149 (= H149), P150 (= P150)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (≠ S214)
- binding pyridoxal-5'-phosphate: F52 (≠ Y52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (= M187), G236 (= G236), V237 (≠ A237), T282 (≠ A283), S310 (= S309), G311 (= G310)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
31% identity, 76% coverage: 4:318/416 of query aligns to 4:319/323 of 7nbcAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E208), A211 (= A212), D213 (≠ S214), G236 (= G236), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (≠ S214)
- binding magnesium ion: N244 (≠ I245)
- binding pyridoxal-5'-phosphate: F52 (≠ Y52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (= M187), G236 (= G236), V237 (≠ A237), T282 (≠ A283), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
31% identity, 76% coverage: 4:318/416 of query aligns to 4:312/320 of 6zspAAA
- active site: K53 (= K53), S74 (≠ A78), E200 (= E208), A204 (= A212), D206 (≠ S214), G229 (= G236), L302 (≠ V308), S303 (= S309)
- binding adenosine-5'-triphosphate: S28 (≠ N28), S29 (≠ E29), I30 (≠ Q30), K48 (≠ A48), T49 (≠ V49), Q79 (= Q83), Y111 (≠ F115), E266 (≠ N274), R267 (≠ N275), K269 (≠ G277), N306 (= N312)
- binding magnesium ion: E200 (= E208), A204 (= A212), D206 (≠ S214)
- binding malonate ion: K53 (= K53), S73 (= S77), S74 (≠ A78), N76 (= N80), H77 (= H81), R125 (≠ Y129), G229 (= G236), S232 (≠ K240)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
31% identity, 76% coverage: 4:318/416 of query aligns to 5:315/322 of 3l6bA
- active site: K54 (= K53), S77 (≠ A78), E203 (= E208), A207 (= A212), D209 (≠ S214), G232 (= G236), T278 (≠ A283), L305 (≠ V308), S306 (= S309)
- binding malonate ion: K54 (= K53), S76 (= S77), S77 (≠ A78), N79 (= N80), H80 (= H81), R128 (≠ Y129), G232 (= G236)
- binding manganese (ii) ion: E203 (= E208), A207 (= A212), D209 (≠ S214)
- binding pyridoxal-5'-phosphate: F53 (≠ Y52), K54 (= K53), N79 (= N80), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), M182 (= M187), V233 (≠ A237), E276 (= E281), T278 (≠ A283), S306 (= S309), G307 (= G310)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
31% identity, 75% coverage: 4:314/416 of query aligns to 4:310/310 of 7nbgDDD
- active site: K53 (= K53), S76 (≠ A78), E202 (= E208), A206 (= A212), D208 (≠ S214), G231 (= G236), L304 (≠ V308), S305 (= S309)
- binding calcium ion: E202 (= E208), A206 (= A212), D208 (≠ S214)
- binding magnesium ion: N239 (≠ I245)
- binding ortho-xylene: S76 (≠ A78), Q81 (= Q83), I96 (= I98), Y113 (≠ F115)
- binding pyridoxal-5'-phosphate: F52 (≠ Y52), K53 (= K53), N78 (= N80), G177 (= G183), G178 (= G184), G179 (= G185), G180 (= G186), M181 (= M187), G231 (= G236), V232 (≠ A237), E275 (= E281), T277 (≠ A283), S305 (= S309), G306 (= G310)
Sites not aligning to the query:
5cvcA Structure of maize serine racemase (see paper)
31% identity, 78% coverage: 9:334/416 of query aligns to 8:327/329 of 5cvcA
- active site: K52 (= K53), S77 (≠ A78), E203 (= E208), A207 (= A212), D209 (≠ S214), G231 (= G236), V306 (= V308), S307 (= S309)
- binding magnesium ion: E203 (= E208), A207 (= A212), D209 (≠ S214)
- binding pyridoxal-5'-phosphate: F51 (≠ Y52), K52 (= K53), N79 (= N80), S178 (≠ G183), G179 (= G184), G180 (= G185), G181 (= G186), L232 (≠ A237), E275 (= E281), S307 (= S309), G308 (= G310)
Query Sequence
>Echvi_3354 FitnessBrowser__Cola:Echvi_3354
MNQVSFQGIIEASEALQEVLHPTPLQFNEQLSEEYGCRVYLKREDLQAVRSYKIRGAYHK
ISSLSEEEKSRGVVCASAGNHAQGVAFACKKLGIKGTIFIPSTTSAQKINRMKLFGKEMV
EIVLSGDTYDDAYQTAAEYCEERGAVFVHPFDDPKVIEGQGTIAKEILDDAEFPVDYLFL
PIGGGGMAAGVSTYFEQSSPETKLIGTEPKGAPSMLTSIQNLKNTVLDEIDGFVDGAAVK
KVGNITFEICRKSLDEMLLVPEGRICTTILNLYNNEGIVVEPAGAMTLAALSLYDKEKLK
GKNVVCVVSGGNNDIMRTAEIKERSLLYEGLKHYFMVQFPQRPGALKDFVSKILGPDDDI
AYFQFTKKNNRENGPAVVGIELKDPQNLPGIFDRLKENRFKYNYLNENLDLLTLLM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory