SitesBLAST
Comparing Echvi_3375 FitnessBrowser__Cola:Echvi_3375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
31% identity, 99% coverage: 3:382/382 of query aligns to 2:385/390 of F0M433
- F13 (= F14) binding
- M14 (≠ I15) binding
- E43 (= E36) binding
- T81 (= T73) binding
- N83 (= N75) binding
- H86 (= H78) binding
- E103 (= E95) binding
- K104 (= K96) binding ; binding
- A130 (≠ H122) binding
- N132 (= N124) binding
- Y133 (≠ L125) binding
- Q163 (= Q155) binding
- W175 (= W166) binding
- R176 (= R167) binding ; binding
- D189 (= D181) binding
- H193 (= H185) binding
- Y335 (≠ F328) binding
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
31% identity, 99% coverage: 3:382/382 of query aligns to 1:369/372 of 6a3iA
- binding Levoglucosan: K103 (= K96), Y132 (≠ L125), Y160 (= Y153), Q162 (= Q155), R175 (= R167), D188 (= D181), H192 (= H185)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (= F14), M13 (≠ I15), E42 (= E36), A43 (≠ V37), P81 (= P74), N82 (= N75), L84 (= L77), H85 (= H78), E102 (= E95), K103 (= K96), W174 (= W166), R175 (= R167)
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
31% identity, 99% coverage: 5:382/382 of query aligns to 2:373/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G13), F11 (= F14), M12 (≠ I15), E41 (= E36), T79 (= T73), P80 (= P74), N81 (= N75), H84 (= H78), E101 (= E95), K102 (= K96), W173 (= W166), R174 (= R167)
- binding alpha-L-sorbopyranose: K102 (= K96), Y131 (≠ L125), Y159 (= Y153), Q161 (= Q155), W163 (= W157), R174 (= R167), D187 (= D181)
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
27% identity, 99% coverage: 1:380/382 of query aligns to 8:387/389 of 7d5mA
- binding nicotinamide-adenine-dinucleotide: G18 (= G11), G20 (= G13), S23 (vs. gap), Q24 (vs. gap), I25 (= I15), D47 (≠ E36), I48 (≠ V37), T92 (= T73), P93 (= P74), N94 (= N75), H97 (= H78), E114 (= E95), K115 (= K96), W190 (= W166), R191 (= R167), H209 (= H185), W333 (≠ S332)
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
27% identity, 99% coverage: 1:380/382 of query aligns to 7:386/389 of 7d5nB
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K114 (= K96), Y143 (≠ L125), R190 (= R167), D204 (= D181), H208 (= H185)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G17 (= G11), G19 (= G13), S22 (vs. gap), Q23 (vs. gap), I24 (= I15), D46 (≠ E36), I47 (≠ V37), T91 (= T73), P92 (= P74), N93 (= N75), H96 (= H78), E113 (= E95), K114 (= K96), W189 (= W166), R190 (= R167), H208 (= H185), W332 (≠ S332)
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
26% identity, 99% coverage: 3:380/382 of query aligns to 5:364/374 of 3dtyA
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
27% identity, 99% coverage: 1:380/382 of query aligns to 7:377/379 of 7d5nA
- binding 1,4-dihydronicotinamide adenine dinucleotide: G17 (= G11), G19 (= G13), S22 (vs. gap), Q23 (vs. gap), I24 (= I15), D46 (≠ E36), I47 (≠ V37), T91 (= T73), P92 (= P74), N93 (= N75), H96 (= H78), E113 (= E95), K114 (= K96), W185 (= W166), R186 (= R167), H199 (= H185), W323 (≠ S332)
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
29% identity, 98% coverage: 5:378/382 of query aligns to 2:358/366 of 5yaqB
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K100 (= K96), Y129 (≠ L125), Y157 (= Y153), E159 (≠ Q155), R172 (= R167), D185 (= D181), H189 (= H185)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), T9 (= T12), G10 (= G13), F11 (= F14), M12 (≠ I15), D39 (≠ E36), M40 (≠ V37), T76 (≠ C72), T77 (= T73), N79 (= N75), H82 (= H78), E99 (= E95), K100 (= K96), N128 (= N124), R172 (= R167), H189 (= H185)
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
29% identity, 98% coverage: 5:378/382 of query aligns to 2:358/366 of 5ya8A
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K100 (= K96), Y129 (≠ L125), Y157 (= Y153), E159 (≠ Q155), R172 (= R167), D185 (= D181), H189 (= H185)
- binding nicotinamide-adenine-dinucleotide: T9 (= T12), G10 (= G13), F11 (= F14), M12 (≠ I15), D39 (≠ E36), M40 (≠ V37), T76 (≠ C72), T77 (= T73), P78 (= P74), N79 (= N75), H82 (= H78), E99 (= E95), K100 (= K96), N128 (= N124), H189 (= H185)
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
29% identity, 98% coverage: 3:378/382 of query aligns to 1:359/368 of 6ktkC
- binding L-glucono-1,5-lactone: K101 (= K96), Y130 (≠ L125), Y158 (= Y153), E160 (≠ Q155), Y162 (≠ W157), D186 (= D181), H190 (= H185)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T10 (= T12), G11 (= G13), F12 (= F14), M13 (≠ I15), D40 (≠ E36), M41 (≠ V37), T77 (≠ C72), T78 (= T73), N80 (= N75), H83 (= H78), E100 (= E95), K101 (= K96), N129 (= N124), H190 (= H185)
7xreC Crystal structure of dgpa
34% identity, 45% coverage: 19:190/382 of query aligns to 20:192/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: D38 (≠ E36), I39 (≠ V37), T78 (= T73), P79 (= P74), N80 (= N75), H83 (= H78), E100 (= E95), K101 (= K96), P102 (= P97), F170 (≠ E169), Q176 (≠ D175), H187 (= H185)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
35% identity, 41% coverage: 35:190/382 of query aligns to 28:182/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K96), R150 (≠ Q155), W157 (= W166), F160 (≠ E169), D173 (= D181), H177 (= H185)
- binding nicotinamide-adenine-dinucleotide: D51 (vs. gap), Y52 (≠ F57), C67 (= C72), T68 (= T73), P69 (= P74), H73 (= H78), E90 (= E95), K91 (= K96), P92 (= P97), Q119 (≠ N124), V159 (≠ L168), F160 (≠ E169), Q166 (≠ D175)
Sites not aligning to the query:
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
26% identity, 76% coverage: 5:294/382 of query aligns to 2:256/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), F11 (= F14), M12 (≠ I15), D33 (≠ E36), L34 (≠ V37), T70 (≠ C72), T71 (= T73), P72 (= P74), N73 (= N75), L75 (= L77), H76 (= H78), Q79 (= Q81), E93 (= E95), K94 (= K96), N122 (= N124), W161 (= W166), H179 (= H185)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
26% identity, 76% coverage: 5:294/382 of query aligns to 2:256/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (= F14), F152 (≠ Y159), N154 (= N161), D175 (= D181), L176 (≠ I182), H179 (= H185), E236 (≠ N268)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G13), F11 (= F14), M12 (≠ I15), D33 (≠ E36), L34 (≠ V37), T70 (≠ C72), T71 (= T73), P72 (= P74), N73 (= N75), L75 (= L77), H76 (= H78), Q79 (= Q81), E93 (= E95), K94 (= K96), N122 (= N124), W161 (= W166), H179 (= H185)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
26% identity, 76% coverage: 5:294/382 of query aligns to 2:256/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (= F14), N154 (= N161), D175 (= D181), H179 (= H185), E236 (≠ N268)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G11), G10 (= G13), F11 (= F14), M12 (≠ I15), D33 (≠ E36), L34 (≠ V37), T70 (≠ C72), T71 (= T73), P72 (= P74), N73 (= N75), L75 (= L77), H76 (= H78), Q79 (= Q81), E93 (= E95), K94 (= K96), N122 (= N124), W161 (= W166)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
32% identity, 44% coverage: 25:193/382 of query aligns to 22:188/333 of Q2I8V6
- S33 (≠ E36) mutation to D: No activity.
- ST 33:34 (≠ EV 36:37) binding
- R38 (≠ L41) binding
- TTNELH 71:76 (≠ TPNFLH 73:78) binding
- EK 93:94 (= EK 95:96) binding
- K94 (= K96) mutation to G: Less than 1% remaining activity.
- N120 (≠ H122) binding
- WR 162:163 (= WR 166:167) binding
- D176 (= D181) mutation to A: Less than 1% remaining activity.
- H180 (= H185) mutation to A: Less than 2% remaining activity.
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 206 G→I: No effect.
- 283 binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
32% identity, 44% coverage: 25:193/382 of query aligns to 21:187/332 of 2glxA
- active site: K93 (= K96), H179 (= H185)
- binding acetate ion: K93 (= K96), H179 (= H185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S32 (≠ E36), T33 (≠ V37), R37 (≠ L41), S69 (≠ C72), T70 (= T73), N72 (= N75), H75 (= H78), E92 (= E95), K93 (= K96), H121 (≠ N124), W161 (= W166), R162 (= R167)
Sites not aligning to the query:
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
30% identity, 50% coverage: 1:192/382 of query aligns to 1:186/332 of B3TMR8
- 17:23 (vs. 17:23, 14% identical) binding
- SR 42:43 (vs. gap) binding
- Y63 (≠ F57) binding
- L79 (≠ T73) binding
- H84 (= H78) binding
- K102 (= K96) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (= R177) binding
- D182 (= D188) binding
- Y186 (= Y192) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
31% identity, 48% coverage: 10:192/382 of query aligns to 3:179/325 of 3rc1A
- active site: K95 (= K96), Y179 (= Y192)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ P17), A11 (= A18), D12 (≠ H19), I13 (≠ L20), S35 (vs. gap), R36 (vs. gap), Y56 (≠ F57), P71 (≠ C72), L72 (≠ T73), P73 (= P74), H77 (= H78), E94 (= E95), K95 (= K96), I162 (≠ S176), R163 (= R177), V168 (≠ I182), D175 (= D188), Y179 (= Y192)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ L23), R17 (= R24), F152 (≠ Y153), I154 (≠ L168), P155 (≠ E169)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
29% identity, 41% coverage: 50:207/382 of query aligns to 50:208/336 of 5a06A
- active site: K101 (= K96), Y186 (≠ H185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y59 (vs. gap), I77 (≠ C72), T78 (= T73), P79 (= P74), N80 (= N75), L82 (= L77), H83 (= H78), E100 (= E95), K101 (= K96), R129 (≠ N124), W168 (= W166), R169 (= R167), Y186 (≠ H185)
- binding sorbitol: D72 (≠ E67), H96 (= H91), K101 (= K96), R122 (≠ L117), R122 (≠ L117), L124 (≠ N119), F160 (≠ L158), R169 (= R167), D182 (= D181), Y186 (≠ H185)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 11, 12, 13, 14, 36, 37, 38, 41, 264
- binding sorbitol: 2, 287, 296, 299, 306, 310, 311
Query Sequence
>Echvi_3375 FitnessBrowser__Cola:Echvi_3375
MTKTIKAAIVGTGFIGPAHLEALRRIPNIEVIALCEVNQELAEEKAKLLGIPQAFTFEEM
LKQPEIEVVHICTPNFLHYNQSKAALEAGKHVVCEKPLATKIDEAEALVALAKEKGLVNA
VHFNLRYYPMVRQMKTMRENGELGDIYSIMGSYLQDWLYLNTDYNWRLEPDKSGDSRAIA
DIGSHLLDLTEYVTGLKITEVMADFSTVHKTRLKPLKPIETYSGKMLQESDYEEVPINTE
DHATVLLRFDNGNKGSVTVSQVNAGRKNRLNIEIAGSKSNFEWCSERPNEMWIGKRESPN
QQLMKDPALFTPEAAGLISFPGGHNEGFPDTSKQMFKEVYAAVAAGKQPENPSFPTFKDG
YRELLICERIIESNQKQAWVKI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory