SitesBLAST
Comparing Echvi_3416 FitnessBrowser__Cola:Echvi_3416 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q3UDW8 Heparan-alpha-glucosaminide N-acetyltransferase; Transmembrane protein 76; EC 2.3.1.78 from Mus musculus (Mouse) (see paper)
29% identity, 99% coverage: 6:363/363 of query aligns to 259:656/656 of Q3UDW8
Sites not aligning to the query:
- 157 modified: carbohydrate, N-linked (GlcNAc...) asparagine
8tu9A Cryo-em structure of hgsnat-acetyl-coa complex at ph 7.5
29% identity, 98% coverage: 7:363/363 of query aligns to 137:533/533 of 8tu9A
Q68CP4 Heparan-alpha-glucosaminide N-acetyltransferase; Transmembrane protein 76; EC 2.3.1.78 from Homo sapiens (Human) (see 10 papers)
29% identity, 98% coverage: 7:363/363 of query aligns to 267:663/663 of Q68CP4
- G290 (≠ S30) to R: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- H297 (= H40) active site; mutation to A: Loss of enzymatic activity, but correctly targeted and processed.
- N301 (= N44) to K: in MPS3C; retained in the endoplasmic reticulum; loss of enzymatic activity
- P311 (= P54) to L: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- C333 (≠ M74) mutation to S: No loss of intralysosomal proteolytic cleavage and enzymatic activity.
- R372 (= R109) to C: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum; to H: in MPS3C; retained in the endoplasmic reticulum; loss of enzymatic activity
- C402 (vs. gap) mutation to S: No loss of intralysosomal proteolytic cleavage and enzymatic activity.
- W431 (= W148) to C: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- G452 (vs. gap) to S: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum; to V: in MPS3C; shows practically no enzyme activity
- C462 (vs. gap) mutation to S: Complete loss of intralysosomal proteolytic cleavage and enzymatic activity. Reduced oligomer formation.
- L473 (≠ Y177) to P: in MPS3C; shows practically no enzyme activity
- H479 (≠ K182) mutation to A: Loss of intralysosomal proteolytic cleavage and enzymatic activity, retained in the endoplasmic reticulum.
- E499 (= E191) to K: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- V509 (≠ A201) to L: in MPS3C; likely benign; no loss of enzymatic activity
- M510 (≠ T202) to K: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- G514 (= G206) to E: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- A517 (= A209) to E: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- S546 (≠ G230) to F: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- K551 (≠ L235) to Q: in MPS3C; likely benign; no loss of enzymatic activity; dbSNP:rs73569592
- S567 (≠ T252) to C: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- S569 (= S254) to L: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity
- D590 (= D275) to V: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity
- P599 (= P285) to L: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity
- H633 (≠ I317) mutation to A: Loss of intralysosomal proteolytic cleavage and enzymatic activity, retained in the endoplasmic reticulum.
- A643 (≠ F339) to T: in RP73 and MPS3C; uncertain significance; may act as a modifier of disease severity in patients with retinitis pigmentosa; has a negligible effect on the enzyme expression; moderately reduced enzyme activity; dbSNP:rs112029032
Sites not aligning to the query:
- 82 A → V: in MPS3C; shows practically no enzyme activity
- 104 C → F: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum; loss of intralysosomal proteolytic cleavage
- 107 C→S: Loss of intralysosomal proteolytic cleavage and enzymatic activity. Reduced oligomer formation.
- 141 L → P: in MPS3C; shows practically no enzyme activity
- 142 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 151 C→S: Loss of intralysosomal proteolytic cleavage and enzymatic activity. Reduced oligomer formation.
- 165 L → P: in MPS3C; results in a negligible amount of protein synthesis; very low enzyme activity; retained in the endoplasmic reticulum
- 179 C→S: Loss of intralysosomal proteolytic cleavage and enzymatic activity.
- 236 L→A: Displayed both lysosomal and plasma membrane localization, reduced intralysosomal proteolytic cleavage and enzymatic activity; when associated with A-209.
- 237 I→A: Displayed both lysosomal and plasma membrane localization, reduced intralysosomal proteolytic cleavage and enzymatic activity; when associated with A-208.
- 265 P → Q: in MPS3C; likely benign; does not influence stability; does not influence activity; does not influence cellular localization of the enzyme
Query Sequence
>Echvi_3416 FitnessBrowser__Cola:Echvi_3416
MANKNKRLISLDVLRGMTIAAMILVNFPGSWEHVFPPLHHAQWNGITPTDFIFPFFLFIV
GVSIVMAYAGKMEMDKTIVYKKLFFRGAKIFALGVLLGMIPEFDFSAIRVAGVLQRIALV
FVACTLMFLNLDWKQQAYLGLLLLVGYWLMMTLIPTPGFDRPMLEPGKNLAAWVDQYLLP
GKMWQDTWDPEGVFSTLPAIATGILGMLAGQLLKSQLKEVEKANNLMVIGLVLTLWGLFW
AWFFPINKNLWTSSFVLVTGGTAFSFLGAFYYWIDVKGNSQGTTPWVIFGSNAITVYVLA
DILSLFFYQLPLDGQSISAHFMQAAKSLGMMPEIASMVFALCFVLINFIPAWLLYRKKVF
IKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory