Comparing Echvi_3547 FitnessBrowser__Cola:Echvi_3547 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 88% coverage: 8:238/262 of query aligns to 1:235/241 of 4u00A
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 82% coverage: 24:239/262 of query aligns to 26:246/265 of P07821
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
28% identity, 89% coverage: 9:241/262 of query aligns to 2:236/240 of 6mjpA
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
30% identity, 95% coverage: 9:256/262 of query aligns to 3:243/247 of P55339
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 88% coverage: 9:238/262 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 88% coverage: 9:238/262 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 88% coverage: 9:238/262 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 88% coverage: 9:238/262 of query aligns to 3:242/242 of 2oljA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
33% identity, 69% coverage: 25:205/262 of query aligns to 21:209/232 of 1f3oA
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
30% identity, 86% coverage: 8:232/262 of query aligns to 3:231/280 of 5x40A
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
30% identity, 85% coverage: 10:231/262 of query aligns to 4:229/262 of 7chaI
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
32% identity, 69% coverage: 25:205/262 of query aligns to 21:209/230 of 1l2tA
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 86% coverage: 12:236/262 of query aligns to 4:238/240 of 4ymuJ
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
26% identity, 87% coverage: 14:241/262 of query aligns to 7:236/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
26% identity, 87% coverage: 14:241/262 of query aligns to 7:236/238 of 6s8gA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 79% coverage: 8:215/262 of query aligns to 16:221/378 of P69874
Sites not aligning to the query:
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
32% identity, 78% coverage: 25:229/262 of query aligns to 23:233/280 of Q5M244
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
26% identity, 87% coverage: 14:240/262 of query aligns to 7:235/235 of 6mhzA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
32% identity, 69% coverage: 24:205/262 of query aligns to 23:207/650 of 5ws4A
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
25% identity, 86% coverage: 14:238/262 of query aligns to 7:233/234 of 6b89A
>Echvi_3547 FitnessBrowser__Cola:Echvi_3547
MIQQIEHPVVEVHDLMVSYGQNPVLWNIDLTLPAGALIGILGPNGAGKSTLIKAIMGLVE
ANSGYSKLFDQALNQVRNRVSYVPQRESVDWDFPASALDIVMMGTYHHLGLFKRPGKKEK
QLAMDCLEKVNMKAFAKRQISELSGGQQQRVFIARALAQQADIYFMDEPFAGVDMSTEKA
LVELFREMTAGGKTVIVVHHDIYSAGTYFDWLIMLNMHLVASGPTKDVLTEELLTKTYGG
KLSTLTDIGEVIKKSDFNPLKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory