Comparing Echvi_3551 FitnessBrowser__Cola:Echvi_3551 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
3tdtA Complex of tetrahydrodipicolinate n-succinyltransferase with 2-amino- 6-oxopimelate and coenzyme a (see paper)
50% identity, 97% coverage: 2:265/271 of query aligns to 3:271/274 of 3tdtA
2tdtA Complex of tetrahydrodipicolinate n-succinyltransferase with 2- aminopimelate and coenzyme a (see paper)
50% identity, 97% coverage: 2:265/271 of query aligns to 3:271/274 of 2tdtA
1kgtA Crystal structure of tetrahydrodipicolinate n-succinyltransferase in complex with pimelate and succinyl-coa (see paper)
50% identity, 97% coverage: 2:265/271 of query aligns to 3:271/274 of 1kgtA
1kgqA Crystal structure of tetrahydrodipicolinate n-succinyltransferase in complex with l-2-aminopimelate and succinamide-coa (see paper)
50% identity, 97% coverage: 2:265/271 of query aligns to 3:271/274 of 1kgqA
3r8yA Structure of the bacillus anthracis tetrahydropicolinate succinyltransferase
39% identity, 35% coverage: 94:187/271 of query aligns to 77:171/203 of 3r8yA
3r5bA Pseudomonas aeruginosa dapd (pa3666) in complex with l-2-aminopimelate (see paper)
31% identity, 46% coverage: 80:204/271 of query aligns to 166:284/321 of 3r5bA
Sites not aligning to the query:
3r5aA Pseudomonas aeruginosa dapd (pa3666) in complex with d-2-aminopimelate (see paper)
31% identity, 46% coverage: 80:204/271 of query aligns to 166:284/321 of 3r5aA
Sites not aligning to the query:
3r5cA Pseudomonas aeruginosa dapd (pa3666) in complex with coa and succinate (see paper)
29% identity, 46% coverage: 80:204/271 of query aligns to 169:285/338 of 3r5cA
Sites not aligning to the query:
>Echvi_3551 FitnessBrowser__Cola:Echvi_3551
MELKTIIENAWENRELLKEKDVEIAVKTVIEDLDKGNIRVAEPLEDGEWQVNDWVKKAVI
LYFPIQKMRTIEVGPFEFHDKMGLKTDYAKQGVRVVPHAVARYGAFLAKGVVMMPSYVNI
GAYVDSGTMVDTWATVGSCAQIGKDVHLSGGVGIGGVLEPVQAAPVIIEDGAFVGSRAII
VEGVRVGKEAVIGAGVTLTASSKIIDVTGDEPKEYRGYVPPRSVVIPGSITKKFAAGEYQ
VPCALIIGQRKASTDRKTSLNEALRDNNVAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory