SitesBLAST
Comparing Echvi_3679 FitnessBrowser__Cola:Echvi_3679 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
48% identity, 95% coverage: 2:180/189 of query aligns to 7:188/188 of 3igjC
- binding acetyl coenzyme *a: F84 (= F77), A106 (= A99), Y112 (= Y105), A114 (= A107), H116 (= H109), G142 (= G134), N148 (≠ C140), A160 (≠ G152), S161 (≠ A153), T166 (= T158), N178 (= N170)
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
45% identity, 95% coverage: 2:180/189 of query aligns to 6:186/186 of 4isxA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
43% identity, 95% coverage: 2:180/189 of query aligns to 5:186/190 of 5u2kA
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
38% identity, 95% coverage: 1:180/189 of query aligns to 4:183/183 of 3nz2C
- binding acetyl coenzyme *a: Y107 (= Y105), H111 (= H109), G137 (= G134), A155 (≠ G152), A156 (= A153), N161 (≠ T158), G171 (≠ V168), T173 (≠ N170), P174 (= P171), L178 (≠ I175), R179 (≠ K176)
- binding magnesium ion: N157 (≠ G154), T173 (≠ N170)
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
38% identity, 94% coverage: 1:178/189 of query aligns to 7:184/185 of 3nz2J
- binding acetyl coenzyme *a: G104 (≠ A99), Y110 (= Y105), H114 (= H109), W138 (= W132), G140 (= G134), A158 (≠ G152), A159 (= A153), N164 (≠ T158), G174 (≠ V168), T176 (≠ N170), P177 (= P171), R182 (≠ K176)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 99% coverage: 2:188/189 of query aligns to 7:195/203 of P07464
- D17 (≠ A12) binding
- S71 (≠ D65) binding
- N85 (= N79) binding in other chain; binding in other chain
- D93 (≠ G87) binding
- H115 (= H109) mutation to A: Results in an 1800-fold decrease in catalytic activity.
- S142 (≠ G135) binding in other chain
- A160 (= A153) binding in other chain
- TK 165:166 (= TK 158:159) binding
- R180 (≠ K173) binding
- R183 (≠ K176) binding in other chain
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; Partial
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
39% identity, 99% coverage: 2:188/189 of query aligns to 6:194/201 of 1krvA
- binding 4-nitrophenyl beta-D-galactopyranoside: D16 (≠ A12), R25 (= R21), S70 (≠ D65), Y82 (≠ F77), N84 (= N79), V90 (≠ L85), D92 (≠ G87), M126 (vs. gap)
- binding coenzyme a: A104 (= A99), S110 (≠ Y105), T112 (≠ A107), W138 (= W132), G140 (= G134), S141 (≠ G135), N146 (≠ C140), A159 (= A153), P177 (= P171), R179 (≠ K173), R182 (≠ K176)
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
39% identity, 99% coverage: 2:188/189 of query aligns to 6:194/201 of 1kruA
- binding coenzyme a: H114 (= H109), W138 (= W132), G140 (= G134), S141 (≠ G135), G158 (= G152), A159 (= A153), P177 (= P171), R182 (≠ K176)
- binding 1-methylethyl 1-thio-beta-D-galactopyranoside: D16 (≠ A12), P22 (≠ I18), R25 (= R21), W62 (≠ H57), S70 (≠ D65), Y82 (≠ F77), Y82 (≠ F77), N84 (= N79), V90 (≠ L85), D92 (≠ G87), L102 (= L97), H114 (= H109), M126 (vs. gap)
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
39% identity, 99% coverage: 2:188/189 of query aligns to 6:194/200 of 1krrA
- binding acetyl coenzyme *a: N84 (= N79), I103 (≠ L98), A104 (= A99), P105 (= P100), T112 (≠ A107), H114 (= H109), G140 (= G134), S141 (≠ G135), N146 (≠ C140), G158 (= G152), A159 (= A153), A174 (≠ V168), P177 (= P171), R182 (≠ K176)
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
36% identity, 95% coverage: 1:180/189 of query aligns to 1:176/176 of 3ectA
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
28% identity, 64% coverage: 56:176/189 of query aligns to 127:278/307 of A1ADJ6
- H210 (= H109) mutation to A: Loss of activity.
- W234 (= W132) mutation to A: Loss of activity.
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
38% identity, 48% coverage: 87:176/189 of query aligns to 57:164/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
38% identity, 48% coverage: 87:176/189 of query aligns to 57:164/211 of 4hurA
- binding acetyl coenzyme *a: S67 (≠ L97), I68 (≠ L98), G69 (≠ A99), A79 (= A107), N80 (≠ R108), K110 (vs. gap), W120 (= W132), I121 (= I133), G122 (= G134), R123 (≠ G135), M128 (≠ C140), A140 (≠ G152), A141 (= A153), T146 (= T158), G156 (≠ V168), P159 (= P171), I163 (= I175), R164 (≠ K176)
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
38% identity, 48% coverage: 87:176/189 of query aligns to 57:164/206 of 6x3jA
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: H91 (vs. gap), L92 (vs. gap), M101 (≠ R123), P102 (= P124), L107 (vs. gap)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ A99), A79 (= A107), H81 (= H109), W120 (= W132), G122 (= G134)
Sites not aligning to the query:
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: 51, 53, 55
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
38% identity, 48% coverage: 87:176/189 of query aligns to 57:164/207 of 6x3cA
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (vs. gap), N80 (≠ R108), H81 (= H109), H91 (vs. gap), L92 (vs. gap), M101 (≠ R123), P102 (= P124), L104 (vs. gap)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ A99), N80 (≠ R108), H81 (= H109), W120 (= W132), G122 (= G134), R123 (≠ G135), M128 (≠ C140), A140 (≠ G152), A141 (= A153)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 17, 36, 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
38% identity, 48% coverage: 87:176/189 of query aligns to 57:164/203 of 6x3cE
- binding magnesium ion: N158 (= N170), P159 (= P171)
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (vs. gap), N80 (≠ R108), H81 (= H109), H91 (vs. gap), L92 (vs. gap), M101 (≠ R123), P102 (= P124)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ A99), H81 (= H109), M83 (≠ L111), W120 (= W132), G122 (= G134), A140 (≠ G152), A141 (= A153)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
36% identity, 50% coverage: 89:182/189 of query aligns to 60:171/204 of 1mrlA
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: N81 (vs. gap), H82 (vs. gap), L93 (≠ V113), M102 (≠ R123), L108 (vs. gap)
Sites not aligning to the query:
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: 37, 39, 54, 56
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
36% identity, 50% coverage: 89:182/189 of query aligns to 60:171/205 of 1kk4A
- binding acetyl coenzyme *a: I69 (≠ L98), G70 (≠ A99), K111 (vs. gap), W121 (= W132), G123 (= G134), K124 (≠ G135), A141 (≠ G152), A142 (= A153), V147 (≠ T158), K148 (= K159), L155 (= L166), G157 (≠ V168), G158 (= G169), P160 (= P171), I164 (= I175)
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
36% identity, 50% coverage: 89:182/189 of query aligns to 60:171/203 of 3dhoA
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
36% identity, 50% coverage: 89:182/189 of query aligns to 60:171/206 of 1khrA
- binding coenzyme a: H82 (vs. gap), M84 (vs. gap), W121 (= W132), A141 (≠ G152), A142 (= A153), V147 (≠ T158), L155 (= L166), G157 (≠ V168), P160 (= P171), I164 (= I175)
- binding virginiamycin m1: A80 (vs. gap), N81 (vs. gap), H82 (vs. gap), L93 (≠ V113)
Sites not aligning to the query:
Query Sequence
>Echvi_3679 FitnessBrowser__Cola:Echvi_3679
MEKMMAGEPYDAHCEDMIRIRTRVKRILHKLNVTEYYTDKFQATINELCPNSAKDLHLEP
PFHCDYGQNIHAGEGVFINFDAVILDGAKVTIGRKTLLAPGVHIYTARHPLNVEERREWE
DCRPVTIGEECWIGGHVTICPGVTIGDRAVIGAGAVVTKDIPADSLAVGNPAKVIKTLNE
KDHKTTYKT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory