Comparing Echvi_3847 FitnessBrowser__Cola:Echvi_3847 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O50146 [LysW]-L-2-aminoadipate 6-phosphate reductase; EC 1.2.1.103 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
31% identity, 98% coverage: 1:315/322 of query aligns to 1:337/344 of O50146
2ozpA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (ttha1904) from thermus thermophilus
31% identity, 97% coverage: 3:315/322 of query aligns to 1:335/342 of 2ozpA
2i3gA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with NADP+. (see paper)
32% identity, 98% coverage: 5:321/322 of query aligns to 6:346/347 of 2i3gA
7npjB Crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine
32% identity, 98% coverage: 5:321/322 of query aligns to 3:343/344 of 7npjB
7nphC Crystal structure of mycobacterium tuberculosis argc in complex with 5-methoxy-1,3-benzoxazole-2-carboxylic acid
32% identity, 98% coverage: 5:321/322 of query aligns to 3:343/344 of 7nphC
7notA Crystal structure of mycobacterium tuberculosis argc in complex with nicotinamide adenine dinucleotide phosphate (NADP+) and 5-methoxy-3- indoleacetic acid
32% identity, 98% coverage: 5:321/322 of query aligns to 3:343/344 of 7notA
7nnrA Crystal structure of mycobacterium tuberculosis argc in complex with xanthene-9-carboxylic acid
32% identity, 98% coverage: 5:321/322 of query aligns to 3:343/344 of 7nnrA
5einA Crystal structure of c148a mutant of lysy from thermus thermophilus in complex with NADP+ and lysw-gamma-aminoadipic acid (see paper)
31% identity, 98% coverage: 1:315/322 of query aligns to 1:337/344 of 5einA
>Echvi_3847 FitnessBrowser__Cola:Echvi_3847
MTKIKTAIIGAAGYTGGELLRILVHHPSCELVYIHSNSQKGKKIDEVHPDLIGDSDLVFT
DEVKTTGLDAVFLGLPHGQAKAFLAENKFDDQTVIIDLSTDFRDESNGFLYGLPEVNASQ
TGQAKRIANPGCFATGIQLALAPAIAAGLAKSDIHITGITGSTGAGKKLSETTHFSQRNQ
NVSVYKLFTHQHLKEISQTFGQLQTGFDQHLLFVPYRGNFSRGIWVTAYFPFEGSLEEAY
KIYHDFYQNAAFTHVSEKDIDLKQVVSTNKCIVHLKKEAGQLVIYSAIDNLLKGASGQAV
QNYNLAFGLNEKEGLRLKSVAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory