Comparing Echvi_3848 FitnessBrowser__Cola:Echvi_3848 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
39% identity, 97% coverage: 6:375/381 of query aligns to 23:394/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 97% coverage: 6:375/381 of query aligns to 15:386/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 97% coverage: 6:375/381 of query aligns to 15:386/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 97% coverage: 6:375/381 of query aligns to 15:386/387 of 1vefA
Sites not aligning to the query:
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
40% identity, 91% coverage: 15:359/381 of query aligns to 22:373/390 of 8ht4B
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
39% identity, 95% coverage: 15:376/381 of query aligns to 23:384/390 of A0QYS9
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
37% identity, 97% coverage: 7:375/381 of query aligns to 8:376/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
37% identity, 97% coverage: 7:375/381 of query aligns to 7:375/375 of 2eh6A
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
37% identity, 99% coverage: 1:376/381 of query aligns to 1:383/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
37% identity, 99% coverage: 1:376/381 of query aligns to 9:391/393 of 2ordA
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 92% coverage: 19:369/381 of query aligns to 85:447/457 of Q9M8M7
Sites not aligning to the query:
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
35% identity, 95% coverage: 18:379/381 of query aligns to 66:440/453 of 4uoxA
Sites not aligning to the query:
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
35% identity, 95% coverage: 18:379/381 of query aligns to 70:444/456 of 4uoxC
Sites not aligning to the query:
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
35% identity, 94% coverage: 18:375/381 of query aligns to 72:442/459 of P42588
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
38% identity, 83% coverage: 6:323/381 of query aligns to 15:336/397 of 4jewA
Sites not aligning to the query:
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
38% identity, 83% coverage: 6:323/381 of query aligns to 15:341/402 of 4jevB
Sites not aligning to the query:
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
38% identity, 83% coverage: 6:323/381 of query aligns to 9:330/389 of 2pb0A
Sites not aligning to the query:
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 83% coverage: 6:323/381 of query aligns to 20:346/405 of P40732
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
36% identity, 96% coverage: 6:371/381 of query aligns to 15:391/400 of 4addA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
36% identity, 96% coverage: 6:371/381 of query aligns to 15:391/401 of 4adbB
>Echvi_3848 FitnessBrowser__Cola:Echvi_3848
MKPFDVYPLIDVTPVKASGSTIWDDQGNEYLDLYGGHAVISIGHSHPHYTKRIKEQLDNI
AFYSNSVQIPIQKELATKLGQLSGYPDYDLFLCNSGAEANENALKLASFETGKKGFIAFT
KGFHGRTSGAVALTDNPKIIAPFNAHEGVHILPFNDLEAVEKQLATGTIAGVIVEGIQGV
GGIQVPDPAFLLGLSALTKQYGAKLILDEVQSGYARSGKFFAHQWVEGLKPDLITVAKGM
GNGFPIGGVLISPEFKASHGLLGTTFGGNHLACAAALAVLEVIDEENLITAAAENGKAIM
AALEKVAGVTEVRGKGLMIGFDLATEAGPVRAALIHEHKIFTGSAGGKHTIRLLPPLNIE
PKALTLFLEKLETVLNVKQST
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory