Comparing Echvi_3850 FitnessBrowser__Cola:Echvi_3850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v5hB Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 (see paper)
36% identity, 86% coverage: 5:234/266 of query aligns to 26:253/289 of 2v5hB
2btyA Acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine (see paper)
37% identity, 92% coverage: 2:247/266 of query aligns to 22:264/282 of 2btyA
Sites not aligning to the query:
Q9X2A4 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
37% identity, 92% coverage: 2:247/266 of query aligns to 22:264/282 of Q9X2A4
Sites not aligning to the query:
2bufA Arginine feed-back inhibitable acetylglutamate kinase (see paper)
33% identity, 98% coverage: 2:261/266 of query aligns to 27:292/292 of 2bufA
Q9HTN2 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
32% identity, 98% coverage: 2:261/266 of query aligns to 28:301/301 of Q9HTN2
Sites not aligning to the query:
2bufC Arginine feed-back inhibitable acetylglutamate kinase (see paper)
32% identity, 92% coverage: 2:247/266 of query aligns to 27:281/298 of 2bufC
Q9SCL7 Acetylglutamate kinase, chloroplastic; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; AtNAGK; EC 2.7.2.8 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
33% identity, 88% coverage: 2:234/266 of query aligns to 86:317/347 of Q9SCL7
Sites not aligning to the query:
2rd5B Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana (see paper)
32% identity, 88% coverage: 2:234/266 of query aligns to 22:253/283 of 2rd5B
Sites not aligning to the query:
4usjB N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii (see paper)
32% identity, 88% coverage: 2:234/266 of query aligns to 20:251/281 of 4usjB
Sites not aligning to the query:
2bufK Arginine feed-back inhibitable acetylglutamate kinase (see paper)
31% identity, 92% coverage: 2:247/266 of query aligns to 27:258/273 of 2bufK
7nlpA Crystal structure of mycobacterium tuberculosis argb in complex with l-canavanine
31% identity, 96% coverage: 2:257/266 of query aligns to 27:286/292 of 7nlpA
Sites not aligning to the query:
7nnbA Crystal structure of mycobacterium tuberculosis argb in complex with 2,8-bis(trifluoromethyl)quinolin-4-ol.
31% identity, 98% coverage: 2:262/266 of query aligns to 26:290/291 of 7nnbA
7nn8A Crystal structure of mycobacterium tuberculosis argb in complex with 1h-indole-3-carbonitrile.
31% identity, 98% coverage: 2:262/266 of query aligns to 26:290/291 of 7nn8A
7nm0A Crystal structure of mycobacterium tuberculosis argb in complex with 1-(2,6-dihydroxyphenyl)ethan-1-one.
31% identity, 98% coverage: 2:262/266 of query aligns to 26:290/291 of 7nm0A
7nlzA Crystal structure of mycobacterium tuberculosis argb in complex with 5-methoxy-6-(trifluoromethyl)indole.
31% identity, 98% coverage: 2:262/266 of query aligns to 26:290/291 of 7nlzA
7nltA Crystal structure of mycobacterium tuberculosis argb in complex with 4-(4-methylpiperazin-1-yl)benzoic acid
31% identity, 98% coverage: 2:262/266 of query aligns to 26:290/291 of 7nltA
7nlrA Crystal structure of mycobacterium tuberculosis argb in complex with 2-phenyl-1h-imidazole
31% identity, 98% coverage: 2:262/266 of query aligns to 26:290/291 of 7nlrA
7nlxA Crystal structure of mycobacterium tuberculosis argb in complex with 7-(trifluoromethyl)quinolin-4-ol.
31% identity, 98% coverage: 2:262/266 of query aligns to 25:289/290 of 7nlxA
7nloA Crystal structure of mycobacterium tuberculosis argb in complex with l-arginine
31% identity, 98% coverage: 2:262/266 of query aligns to 24:288/289 of 7nloA
Sites not aligning to the query:
7nlnA Crystal structure of mycobacterium tuberculosis argb in complex with n-acetyl-glutamate
31% identity, 98% coverage: 2:262/266 of query aligns to 25:289/290 of 7nlnA
>Echvi_3850 FitnessBrowser__Cola:Echvi_3850
MKISIVKIGGNVIDDPAKLQEFLMLFARLEGKKILVHGGGVMASKFGQQLGIEPKMVDGR
RITDEATLDVVTMVYAGMINKKIVAKLQQLEQNAMGFTGADGNLIRSAKRPVKDIDYGFV
GDVKEVDTELMEVLLEKDVVPVFSAITHDRKGNLLNTNADTIASEIATAMAVKHTVRLYF
CFNKAGVLIDEHNDDSLVPKINEDIYDELKRDNVIHSGMIPKLDNAFSALHKGVSNVWLG
KAENLILASKGKKSGTNIERHRYDLY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory