Comparing Echvi_3851 FitnessBrowser__Cola:Echvi_3851 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
29% identity, 90% coverage: 18:343/362 of query aligns to 7:363/380 of 7rsfA
7lgpB Dape enzyme from shigella flexneri
26% identity, 67% coverage: 18:259/362 of query aligns to 9:265/377 of 7lgpB
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
28% identity, 68% coverage: 13:259/362 of query aligns to 2:264/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
28% identity, 68% coverage: 13:259/362 of query aligns to 2:264/376 of 4o23A
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
22% identity, 81% coverage: 66:360/362 of query aligns to 69:401/408 of Q03154
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
22% identity, 94% coverage: 19:360/362 of query aligns to 15:400/407 of P37111
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
27% identity, 78% coverage: 6:288/362 of query aligns to 2:297/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
26% identity, 77% coverage: 12:288/362 of query aligns to 1:293/377 of P44514
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
25% identity, 72% coverage: 13:274/362 of query aligns to 48:385/503 of Q8C165
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
24% identity, 79% coverage: 70:356/362 of query aligns to 65:364/366 of Q8P8J5
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
26% identity, 70% coverage: 34:288/362 of query aligns to 22:293/377 of 7t1qA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
25% identity, 96% coverage: 9:357/362 of query aligns to 2:374/383 of 7uoiA
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
23% identity, 79% coverage: 70:356/362 of query aligns to 66:359/360 of 2f7vA
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
28% identity, 43% coverage: 12:167/362 of query aligns to 3:167/258 of 4h2kA
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
29% identity, 55% coverage: 71:268/362 of query aligns to 16:213/392 of 7m6uB
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
29% identity, 55% coverage: 71:268/362 of query aligns to 81:278/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
29% identity, 55% coverage: 71:268/362 of query aligns to 106:303/415 of P06621
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
35% identity, 24% coverage: 66:152/362 of query aligns to 88:177/475 of Q9D1A2
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
35% identity, 24% coverage: 66:152/362 of query aligns to 92:181/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
35% identity, 24% coverage: 66:152/362 of query aligns to 92:181/478 of 2zofA
Sites not aligning to the query:
>Echvi_3851 FitnessBrowser__Cola:Echvi_3851
MLQTFSNAMQQLKAEAKELLKQLIETPSLSREEDHTAKLLEEYLTSKGIPAKRLQNNVWA
TNKHFDPNLPNVLLNSHHDTVKPNNGYTKDPFKAIEEEGKLYGLGSNDAGGCLVSLIAAF
VHLYDQKLPFNLILAATAEEEVSGKNGIALLLEELPTIALAIVGEPTLLDVAVAEKGLMV
IDATVTGKAGHAARNEGINALYEALPDLNTLKDYSFKRVSEYLGESKVSATIIQAGSQHN
VVPDKCVYTLDVRVTDSYTLQEALDELKGFLKADLQPRSMRLNSSALPKGHRIWEVIHQL
SLKCYGSPTLSDQALIPYPSIKIGPGDSARSHTPDEFIHLKEIDQGIDRYVDILNGYADL
TN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory