SitesBLAST
Comparing Echvi_3882 FitnessBrowser__Cola:Echvi_3882 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
31% identity, 97% coverage: 1:319/328 of query aligns to 2:281/283 of 1ynpA
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
30% identity, 97% coverage: 1:319/328 of query aligns to 2:296/298 of 1ynqB
- active site: D47 (= D52), Y52 (= Y57), K86 (≠ S92), H120 (= H122)
- binding beta-D-fructofuranose: K4 (≠ Y3), N44 (= N49), D71 (≠ Q76)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G19), C21 (≠ T20), M22 (≠ W21), S23 (≠ Q22), D47 (= D52), Y52 (= Y57), K77 (= K82), S150 (= S153), M170 (≠ Q173), R197 (= R201), G198 (≠ V202), P199 (= P203), V200 (≠ L204), R202 (≠ S206), S206 (= S210), R208 (≠ K212), A255 (≠ I283), A256 (≠ P284), G257 (= G285), S259 (= S287), Q263 (= Q291), N267 (= N295)
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
30% identity, 97% coverage: 1:319/328 of query aligns to 2:296/298 of 1ynpB
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
31% identity, 90% coverage: 1:294/328 of query aligns to 1:289/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
31% identity, 90% coverage: 1:294/328 of query aligns to 1:289/333 of 1pz1A
- active site: D52 (= D52), Y57 (= Y57), K90 (vs. gap), Q93 (= Q86), H125 (= H122)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), W21 (= W21), Q175 (= Q173), Y203 (≠ R201), G204 (≠ V202), L206 (= L204), R208 (≠ S206), K214 (= K212), G280 (= G285), R282 (≠ S287), Q286 (= Q291)
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 89% coverage: 6:298/328 of query aligns to 6:304/326 of P77256
- D232 (≠ E216) mutation D->A,E: Converts the protein into an enzyme with dual specificity, i.e. that is able to use both NADPH and NADH as cosubstrates.
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
28% identity, 97% coverage: 1:317/328 of query aligns to 1:310/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
28% identity, 95% coverage: 5:317/328 of query aligns to 4:309/311 of 1pz0A
- active site: D52 (= D52), Y57 (= Y57), N91 (= N88), H124 (= H122)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H124 (= H122), Q174 (= Q173), Y202 (≠ R201), F203 (≠ V202), P204 (= P203), L205 (= L204), S207 (= S206), G208 (= G207), A211 (≠ S210), K213 (= K212)
8hw0A The structure of akr6d1
33% identity, 91% coverage: 1:300/328 of query aligns to 1:302/329 of 8hw0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), W21 (= W21), Q27 (≠ W27), D49 (= D52), Y54 (= Y57), R123 (≠ C123), S152 (= S153), Q178 (≠ T171), W207 (≠ R201), S208 (≠ V202), P209 (= P203), L210 (= L204), S212 (= S206), K218 (= K212), S227 (≠ H224), R228 (= R225), I285 (= I283), G287 (= G285), S289 (= S287), Q293 (= Q291), D296 (≠ A294), N297 (= N295)
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
33% identity, 70% coverage: 5:232/328 of query aligns to 18:241/286 of 8hnqA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G31 (= G19), M33 (≠ W21), R34 (≠ Q22), Y71 (= Y57), R138 (≠ C123), Q187 (= Q173), W214 (≠ R201), A215 (≠ V202), P216 (= P203), L217 (= L204), S219 (= S206), G220 (= G207)
- binding 1,4,7,10,13,16-hexaoxacyclooctadecane: L98 (≠ R85), W106 (≠ H90), R138 (≠ C123)
Sites not aligning to the query:
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
27% identity, 91% coverage: 1:298/328 of query aligns to 1:292/337 of Q3L181
- D52 (= D52) mutation to A: 99% loss of activity.
- Y57 (= Y57) mutation to A: 99% loss of activity.
- K84 (= K82) mutation to A: Total loss of activity.
- H126 (= H122) mutation to A: 98% loss of activity.
1exbA Structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels (see paper)
26% identity, 95% coverage: 3:315/328 of query aligns to 4:319/326 of 1exbA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G19), W22 (= W21), Q28 (≠ G30), D50 (= D52), Y55 (= Y57), S153 (= S153), R154 (≠ K156), Q179 (vs. gap), W208 (≠ R201), S209 (≠ V202), P210 (= P203), L211 (= L204), C213 (≠ S206), G214 (= G207), S217 (= S210), K219 (= K212), S228 (≠ R225), R229 (≠ H226), L286 (≠ I283), G288 (= G285), S290 (= S287), Q294 (= Q291), E297 (≠ A294), N298 (= N295)
3eauA Voltage-dependent k+ channel beta subunit in complex with cortisone (see paper)
26% identity, 95% coverage: 3:315/328 of query aligns to 5:320/327 of 3eauA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G19), W23 (= W21), Q29 (≠ G30), D51 (= D52), Y56 (= Y57), K84 (= K82), S154 (= S153), Q180 (vs. gap), W209 (≠ R201), S210 (≠ V202), P211 (= P203), L212 (= L204), A213 (= A205), C214 (≠ S206), G215 (= G207), K220 (= K212), R230 (≠ H226), L287 (≠ I283), L288 (≠ P284), G289 (= G285), S291 (= S287), Q295 (= Q291), E298 (≠ A294), N299 (= N295)
- binding 17,21-dihydroxypregna-1,4-diene-3,11,20-trione: W23 (= W21), V55 (= V56), Y56 (= Y57), W87 (≠ R85), N124 (≠ H122), R155 (≠ K156), I174 (= I175), I177 (vs. gap), I202 (≠ K194)
P62483 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; EC 1.1.1.- from Rattus norvegicus (Rat) (see 11 papers)
26% identity, 98% coverage: 3:323/328 of query aligns to 39:364/367 of P62483
- T56 (= T20) binding
- W57 (= W21) binding
- Q63 (≠ G30) binding
- D85 (= D52) binding
- Y90 (= Y57) mutation to F: Abolishes enzyme activity, but has no effect on NADPH binding.
- S112 (≠ Q76) modified: Phosphoserine
- N158 (≠ H122) binding
- S188 (= S153) binding
- R189 (≠ K156) binding
- Q214 (vs. gap) binding
- W243 (≠ R201) binding
- S244 (≠ V202) binding
- P245 (= P203) binding
- L246 (= L204) binding
- A247 (= A205) binding
- C248 (≠ S206) binding
- K254 (= K212) binding
- Y262 (≠ H224) binding
- R264 (≠ H226) binding
- G323 (= G285) binding
- S325 (= S287) binding
- Q329 (= Q291) binding
- E332 (≠ A294) binding
- N333 (= N295) binding
Sites not aligning to the query:
- 9 modified: Phosphoserine; S→A: Impairs interaction with MAPRE1 and association with microtubules.
- 20 modified: Phosphoserine; S→A: No effect on interaction with MAPRE1 and association with microtubules.
- 31 S→A: Impairs interaction with MAPRE1 and association with microtubules.
P62482 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; Neuroimmune protein F5; EC 1.1.1.- from Mus musculus (Mouse) (see 2 papers)
26% identity, 98% coverage: 3:323/328 of query aligns to 39:364/367 of P62482
- Y90 (= Y57) mutation to F: No detectable phenotype.
- S112 (≠ Q76) modified: Phosphoserine
Sites not aligning to the query:
- 20 modified: Phosphoserine
7ezlA Rice l-galactose dehydrogenase (holo form)
27% identity, 91% coverage: 1:299/328 of query aligns to 3:283/318 of 7ezlA
- binding magnesium ion: D129 (≠ R130), D131 (= D132)
- binding nicotinamide-adenine-dinucleotide: G21 (= G19), S23 (≠ W21), P24 (≠ Q22), L25 (≠ V23), D53 (= D52), D124 (≠ P125), T156 (≠ S153), Y181 (≠ M178), A208 (≠ R201), S209 (≠ V202), L211 (= L204), M213 (≠ S206), T250 (≠ A266), G269 (= G285), Q275 (= Q291), E278 (≠ A294), N279 (= N295)
7wf3C Composite map of human kv1.3 channel in apo state with beta subunits (see paper)
25% identity, 95% coverage: 3:315/328 of query aligns to 6:321/328 of 7wf3C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G19), R156 (≠ K156), W210 (≠ R201), S211 (≠ V202), P212 (= P203), L213 (= L204), C215 (≠ S206), K221 (= K212), R231 (≠ H226), Q296 (= Q291), E299 (≠ A294), N300 (= N295)
7eziA Rice l-galactose dehydrogenase (apo form)
27% identity, 91% coverage: 1:299/328 of query aligns to 8:288/323 of 7eziA
Q13303 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; hKvbeta2; EC 1.1.1.- from Homo sapiens (Human) (see 2 papers)
26% identity, 98% coverage: 3:323/328 of query aligns to 39:364/367 of Q13303
- T56 (= T20) binding
- W57 (= W21) binding
- Q63 (≠ G30) binding
- D85 (= D52) binding
- Y90 (= Y57) mutation to F: No effect on its activity in promoting KCNA4 channel closure.
- S112 (≠ Q76) modified: Phosphoserine
- S188 (= S153) binding
- R189 (≠ K156) binding
- Q214 (vs. gap) binding
- W243 (≠ R201) binding
- S244 (≠ V202) binding
- P245 (= P203) binding
- L246 (= L204) binding
- A247 (= A205) binding
- C248 (≠ S206) binding
- K254 (= K212) binding
- R264 (≠ H226) binding
- S325 (= S287) binding
- Q329 (= Q291) binding
- E332 (≠ A294) binding
- N333 (= N295) binding
Sites not aligning to the query:
- 31 modified: Phosphoserine
P63144 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Rattus norvegicus (Rat) (see paper)
26% identity, 94% coverage: 1:307/328 of query aligns to 71:380/401 of P63144
- K152 (= K82) mutation to M: Loss of enzyme activity.
Query Sequence
>Echvi_3882 FitnessBrowser__Cola:Echvi_3882
MNYRKLGGTDIEVSEVSLGTWQVGGGWGGGFDEKAAAKILHEAVDGGVNFIDTADVYDDG
KSEAAVGRLLKERSEQLYVASKCGRQINPHVSEGYTPEALRKYVEASLKNIGIETLDLIQ
LHCPPTAVYRRDEIFELFDRLKEEGKIKHLGVSVEKVTEAELALNYPNVKTVQIIFNMFR
QKPADSFFELAKAKDVGVIVRVPLASGLLSGKMDRERVFDKNDHRHFNREGQAFDKGETF
SGVDFEKGLEAVAALKDVLGEEEPLAAWALRWILMFDQVSTVIPGASRPSQVKANLLASA
LPALTAQQMEAVKAVYAQYIKPDVHHLW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory