SitesBLAST
Comparing Echvi_3892 FitnessBrowser__Cola:Echvi_3892 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
26% identity, 94% coverage: 23:408/412 of query aligns to 14:391/396 of 5f7qE
- binding zinc ion: H243 (= H251), C253 (= C262), C255 (= C264), C260 (= C269)
- binding : N15 (= N24), T32 (≠ S41), S43 (≠ P52), T44 (= T53), T67 (≠ Q76), G68 (= G77), G68 (= G77), G69 (= G78), G69 (= G78), R70 (= R79), R70 (= R79), R71 (≠ K80), A72 (≠ P81), K73 (≠ D82)
Sites not aligning to the query:
1z6rA Crystal structure of mlc from escherichia coli (see paper)
26% identity, 77% coverage: 89:407/412 of query aligns to 59:371/382 of 1z6rA
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
26% identity, 77% coverage: 89:407/412 of query aligns to 83:395/406 of P50456
- H86 (≠ Y92) mutation to R: Can be bound and inactivated by MtfA.
- F136 (≠ M143) mutation to A: Decreases association with PtsG EIIB domain.
- H247 (= H251) binding
- C257 (= C262) binding ; mutation to A: Strongly reduced activity; when associated with A-259.; mutation to S: Strongly reduced activity; when associated with S-259.
- C259 (= C264) binding ; mutation to A: Strongly reduced activity; when associated with A-257.; mutation to S: Strongly reduced activity; when associated with S-257.
- C264 (= C269) binding
- R306 (≠ A317) mutation to G: Forms dimers but not tetramers; when associated with G-310.
- L310 (≠ R321) mutation to G: Forms dimers but not tetramers; when associated with G-306.
Sites not aligning to the query:
- 52 R→H: Shows increased expression and forms larger colonies.
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
30% identity, 67% coverage: 134:411/412 of query aligns to 121:389/396 of 1z05A
2qm1B Crystal structure of glucokinase from enterococcus faecalis
30% identity, 62% coverage: 151:404/412 of query aligns to 66:321/325 of 2qm1B
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
29% identity, 62% coverage: 152:407/412 of query aligns to 60:306/306 of 5f7rA
- binding alpha-D-glucopyranose: G70 (= G162), N110 (≠ D199), N110 (≠ D199), S134 (≠ F223), V135 (= V224), G138 (= G227), L139 (≠ I228), G140 (= G229), E159 (= E248), H162 (= H251), E181 (= E271), E253 (≠ S354), W293 (≠ G394)
- binding zinc ion: H162 (= H251), C172 (= C262), C174 (= C264), C179 (= C269)
Sites not aligning to the query:
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
27% identity, 74% coverage: 94:397/412 of query aligns to 4:304/312 of 3vglA
- binding phosphoaminophosphonic acid-adenylate ester: G9 (≠ S99), T11 (≠ F101), K12 (≠ V102), G130 (= G225), T131 (≠ W226), G180 (= G276), G214 (≠ P308), S218 (≠ V312), G260 (≠ S354), V261 (= V355), E264 (≠ A358)
- binding beta-D-glucopyranose: G65 (= G162), P78 (≠ T173), N103 (= N198), D104 (= D199), L133 (≠ I228), G134 (= G229), E153 (= E248), H156 (= H251), E175 (= E271)
- binding zinc ion: H156 (= H251), C166 (= C262), C168 (= C264), C173 (= C269)
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
27% identity, 74% coverage: 94:397/412 of query aligns to 4:304/312 of 3vgkB
Q9Y223 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Homo sapiens (Human) (see 18 papers)
28% identity, 68% coverage: 89:370/412 of query aligns to 405:688/722 of Q9Y223
- D413 (= D97) binding
- G416 (≠ K100) binding
- T417 (≠ F101) binding
- N418 (≠ V102) binding
- R420 (= R104) binding
- I472 (≠ M158) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 50% of the wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity
- G476 (= G162) binding ; binding
- R477 (≠ L163) binding ; binding
- T489 (= T173) binding ; binding
- N516 (= N198) binding ; binding
- D517 (= D199) active site; binding ; binding ; mutation D->A,N: Loss of N-acylmannosamine kinase activity. Decreased affinity for N-acyl-D-mannosamine. No effect on structure.
- N519 (≠ R201) to S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs1554658910; mutation to S: Decreased N-acylmannosamine kinase activity.
- A524 (= A206) to V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs764698870
- F528 (= F210) to C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; dbSNP:rs986773986; mutation to C: Decreased N-acylmannosamine kinase activity.
- G545 (= G227) binding
- E566 (= E248) binding
- H569 (= H251) binding ; binding ; binding
- V572 (≠ F255) to L: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70-80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity; does not affect homohexamers formation; dbSNP:rs121908632
- G576 (≠ E259) to E: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs121908625
- C579 (= C262) binding
- C581 (= C264) binding
- C586 (= C269) binding
- I587 (≠ L270) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs748949603; mutation to T: Decreased N-acylmannosamine kinase activity.
- E588 (= E271) binding ; binding
- A630 (= A314) to T: in NM; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs1382191649
- A631 (= A315) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs121908626; to V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs62541771; mutation A->V,T: Decreased N-acylmannosamine kinase activity.
Sites not aligning to the query:
- 13 C → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; dbSNP:rs1209266607
- 19 binding
- 23 binding
- 113 binding
- 132 H → Q: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; impaired homohexamers formation
- 176 D → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs139425890
- 177 R → C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs539332585
- 200 I → F: in NM; uncertain significance; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 90% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs369328625
- 206 G → S: in NM; moderate phenotype with unusual involvement of quadriceps; dbSNP:rs766266918
- 220 binding
- 253 binding
- 259 binding
- 263 R → L: in SIALURIA; strong reduction of feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908623
- 266 R → Q: in SIALURIA; abolishes feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908622; R → W: in sialuria; dbSNP:rs121908621
- 271 binding
- 280 binding
- 281 binding
- 282 binding
- 301 binding
- 302 binding
- 303 C → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to 60% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs121908633
- 307 binding
- 321 binding
- 331 V → A: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation
- 378 D → Y: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 10-30% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs199877522
- 708 G → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; severely decreased; dbSNP:rs1554657922
- 712 M→T: Decreased N-acylmannosamine kinase activity.
O35826 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Rattus norvegicus (Rat) (see paper)
28% identity, 68% coverage: 89:370/412 of query aligns to 405:688/722 of O35826
- D413 (= D97) mutation D->K,N: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
- R420 (= R104) mutation to M: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
Sites not aligning to the query:
- 1 UDP-N-acetylglucosamine 2-epimerase
- 49 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Does not interfere with enzyme oligomerization.
- 110 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 132 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 155 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 157 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 406:722 N-acetylmannosamine kinase
2yhwA High-resolution crystal structures of n-acetylmannosamine kinase: insights about substrate specificity, activity and inhibitor modelling. (see paper)
28% identity, 68% coverage: 90:370/412 of query aligns to 2:280/309 of 2yhwA
2yi1A Crystal structure of n-acetylmannosamine kinase in complex with n- acetyl mannosamine 6-phosphate and adp. (see paper)
28% identity, 68% coverage: 90:370/412 of query aligns to 2:279/308 of 2yi1A
- binding adenosine-5'-diphosphate: G11 (≠ S99), T13 (≠ F101), N14 (≠ V102), R16 (= R104), T140 (≠ W226), G189 (= G276), L216 (≠ S309), V261 (≠ S354)
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-mannopyranose: G12 (≠ K100), G71 (≠ P161), G72 (= G162), R73 (≠ L163), S84 (≠ H172), T85 (= T173), L87 (= L175), N112 (= N198), D113 (= D199), G139 (= G225), T140 (≠ W226), G141 (= G227), I142 (= I228), E162 (= E248), H165 (= H251), E184 (= E271)
- binding calcium ion: N112 (= N198), N115 (≠ R201), G144 (≠ L230), A161 (≠ G247)
- binding zinc ion: H165 (= H251), C175 (= C262), C177 (= C264), C182 (= C269)
2yhyA Structure of n-acetylmannosamine kinase in complex with n- acetylmannosamine and adp (see paper)
28% identity, 68% coverage: 90:370/412 of query aligns to 2:279/308 of 2yhyA
- binding adenosine-5'-diphosphate: G11 (≠ S99), G12 (≠ K100), T13 (≠ F101), N14 (≠ V102), R16 (= R104), T140 (≠ W226), G189 (= G276), L216 (≠ S309), V261 (≠ S354)
- binding calcium ion: N112 (= N198), N115 (≠ R201), G144 (≠ L230), A161 (≠ G247)
- binding zinc ion: H165 (= H251), C175 (= C262), C177 (= C264), C182 (= C269)
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
28% identity, 50% coverage: 191:397/412 of query aligns to 95:280/290 of 6jdbA
- binding adenosine-5'-diphosphate: S129 (≠ G225), T130 (≠ W226), P195 (= P308), K196 (≠ S309), S241 (= S354)
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-mannopyranose: N102 (= N198), D103 (= D199), S129 (≠ G225), T130 (≠ W226), H152 (≠ E248), H155 (= H251), E174 (= E271)
- binding zinc ion: H155 (= H251), C165 (= C262), C167 (= C264), C172 (= C269)
Sites not aligning to the query:
3eo3A Crystal structure of the n-acetylmannosamine kinase domain of human gne protein (see paper)
33% identity, 43% coverage: 194:370/412 of query aligns to 83:259/288 of 3eo3A
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
28% identity, 54% coverage: 156:378/412 of query aligns to 68:287/311 of 4db3A
6jdcA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac from haemophilus influenzae
32% identity, 35% coverage: 191:334/412 of query aligns to 96:227/269 of 6jdcA
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
26% identity, 54% coverage: 182:404/412 of query aligns to 87:288/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
26% identity, 54% coverage: 182:404/412 of query aligns to 87:288/293 of 6jdhA
P32718 D-allose kinase; Allokinase; EC 2.7.1.55 from Escherichia coli (strain K12) (see paper)
27% identity, 39% coverage: 219:380/412 of query aligns to 134:285/309 of P32718
- F145 (≠ L230) mutation to L: 10-fold increase in catalytic efficiency for glucose phosphorylation. Slight increase in catalytic efficiency for D-allose phosphorylation.
Sites not aligning to the query:
- 73 A→G: 60-fold increase in catalytic efficiency for glucose phosphorylation. 45-fold increase in D-glucose affinity. No change in catalytic efficiency for D-allose phosphorylation.
Query Sequence
>Echvi_3892 FitnessBrowser__Cola:Echvi_3892
MNLIDPKKSLDEKEGVVEIKNYLNKIKIIKNLYMNGSNTASEICNEVGISLPTVNSLLTD
LIKAGKLVKQGRAESQGGRKPDLYRLAQDSFYVLALDISKFVVRAAIYDSSNQAVTETGT
FKITLNNEKSTFDKIGDFMETYMQESGIPNEKIIAIGMSMPGLVDSVNGVNHTYLKFGKK
SLVENFEARFDRKVFIENDARAMTLAEFKFSQDQKYNNVLGIFVGWGIGLGIIIDGKLYR
GGAGFAGEFSHSPIFESREISCTCGKKGCLEAVASGTAMVRMAEEAIEKDSDSILSRMAR
ERGEGIDPSLIVDAALAGDQRAITILSDVGLDLGRGISILIQLLNPDLIIVGGSVAEAQQ
YLITPIQQALNIFSMAKSREKSELTLYKLGKEVGLLGGVAVVIENIFEDIIN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory