Comparing Echvi_3894 FitnessBrowser__Cola:Echvi_3894 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
27% identity, 88% coverage: 24:280/291 of query aligns to 21:301/306 of 5f7rA
Sites not aligning to the query:
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
26% identity, 88% coverage: 24:280/291 of query aligns to 102:385/396 of 5f7qE
Sites not aligning to the query:
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
28% identity, 92% coverage: 7:275/291 of query aligns to 3:281/297 of Q93LQ8
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
25% identity, 95% coverage: 8:282/291 of query aligns to 4:289/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
25% identity, 95% coverage: 8:282/291 of query aligns to 4:289/293 of 6jdhA
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
30% identity, 77% coverage: 9:233/291 of query aligns to 5:257/303 of 7p9lAAA
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
30% identity, 77% coverage: 9:233/291 of query aligns to 6:258/304 of 7p9pAAA
Sites not aligning to the query:
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
30% identity, 77% coverage: 9:233/291 of query aligns to 8:260/306 of 7p7wBBB
Sites not aligning to the query:
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
25% identity, 82% coverage: 44:282/291 of query aligns to 118:383/396 of 1z05A
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
25% identity, 82% coverage: 44:282/291 of query aligns to 124:393/406 of P50456
Sites not aligning to the query:
1z6rA Crystal structure of mlc from escherichia coli (see paper)
25% identity, 87% coverage: 29:282/291 of query aligns to 88:369/382 of 1z6rA
2qm1B Crystal structure of glucokinase from enterococcus faecalis
27% identity, 96% coverage: 4:281/291 of query aligns to 5:321/325 of 2qm1B
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
28% identity, 95% coverage: 2:278/291 of query aligns to 5:307/311 of 4db3A
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
28% identity, 84% coverage: 7:251/291 of query aligns to 3:251/289 of 2gupA
Sites not aligning to the query:
6jdcA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac from haemophilus influenzae
25% identity, 94% coverage: 8:281/291 of query aligns to 4:267/269 of 6jdcA
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
25% identity, 94% coverage: 8:281/291 of query aligns to 4:287/290 of 6jdbA
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
27% identity, 78% coverage: 6:233/291 of query aligns to 2:261/312 of 3vglA
Sites not aligning to the query:
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
27% identity, 78% coverage: 6:233/291 of query aligns to 2:261/312 of 3vgkB
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
32% identity, 45% coverage: 7:138/291 of query aligns to 3:134/298 of 3vovB
Sites not aligning to the query:
1xc3A Structure of a putative fructokinase from bacillus subtilis (see paper)
27% identity, 89% coverage: 6:263/291 of query aligns to 2:266/295 of 1xc3A
>Echvi_3894 FitnessBrowser__Cola:Echvi_3894
MKKNRLILGLDIGGTSINAGIMKDGELIEKREIPTPSQEPQEVILSTIADFIASYFSHEI
DGIGIGIPGLVDAEKGIVYNLENIPAFNKVALKDYLERTLEKPVYINNDANCFALGEYKF
GGANKHRHMVGITLGTGIGTGVITNGELYPGFLCGAGEWGGVPYLDSNFENYCSSKFFRK
LHHTTAKKLAAKAAEGDQEALKLFYEYGTHIGNLIKYILFTYAPEAIVIGGSIRKAFPYF
SKGLKETVETFPYSSISDNLTIYTSSFDDSAIMGAAALVTEAESHVANLAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory