SitesBLAST
Comparing Echvi_3936 FitnessBrowser__Cola:Echvi_3936 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cukA Structure of salmonella d-lactate dehydrogenase in complex with nadh
54% identity, 99% coverage: 1:327/330 of query aligns to 1:328/330 of 4cukA
- active site: S101 (= S99), R234 (= R233), D258 (= D257), E263 (= E262), H295 (= H294)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y98), G153 (= G151), K154 (= K152), I155 (= I153), F173 (≠ Y171), D174 (= D172), P175 (= P173), H204 (= H203), C205 (≠ L204), P206 (= P205), N211 (≠ S210), T232 (= T231), Y260 (= Y259), H295 (= H294), A297 (= A296)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
52% identity, 96% coverage: 1:317/330 of query aligns to 8:325/336 of 5z20F
- active site: S108 (= S99), R241 (= R233), D265 (= D257), E270 (= E262), H302 (= H294)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y98), G160 (= G151), Q161 (≠ K152), I162 (= I153), Y180 (= Y171), D181 (= D172), P182 (= P173), C212 (≠ L204), P213 (= P205), T218 (≠ S210), T239 (= T231), G240 (≠ S232), R241 (= R233), H302 (= H294), A304 (= A296)
8grvA Dictyostelium discoideum lactate dehydrogenase (dicldha)with NAD
46% identity, 95% coverage: 1:314/330 of query aligns to 3:318/336 of 8grvA
- binding nicotinamide-adenine-dinucleotide: V106 (≠ I103), G154 (= G151), N155 (≠ K152), I156 (= I153), D176 (= D172), I177 (≠ P173), I178 (≠ Y174), T208 (≠ L204), P209 (= P205), T214 (≠ S210), V235 (≠ T231), H298 (= H294), A300 (= A296), W301 (≠ F297)
5z21B The ternary structure of d-lactate dehydrogenase from fusobacterium nucleatum with nadh and oxamate (see paper)
46% identity, 99% coverage: 2:327/330 of query aligns to 3:329/331 of 5z21B
- active site: S101 (= S99), R235 (= R233), D259 (= D257), E264 (= E262), H296 (= H294)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y98), I105 (= I103), G153 (= G151), K154 (= K152), I155 (= I153), D174 (= D172), L175 (≠ P173), P207 (= P205), T212 (≠ S210), T233 (= T231), G234 (≠ S232), R235 (= R233), H296 (= H294), Y299 (≠ F297)
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
45% identity, 92% coverage: 27:329/330 of query aligns to 39:346/346 of 4zgsA
- active site: S111 (= S99), R244 (= R233), D268 (= D257), E273 (= E262), H311 (= H294)
- binding nicotinamide-adenine-dinucleotide: Y110 (= Y98), G163 (= G151), A164 (≠ K152), I165 (= I153), D184 (= D172), C215 (≠ L204), P216 (= P205), L218 (≠ S207), S220 (= S209), T221 (≠ S210), S243 (= S232), H311 (= H294), F314 (= F297)
2dldA D-lactate dehydrogenase complexed with nadh and oxamate
35% identity, 98% coverage: 2:324/330 of query aligns to 3:326/337 of 2dldA
- active site: S103 (= S99), R236 (= R233), D260 (= D257), E265 (= E262), H297 (= H294)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T154 (= T150), G155 (= G151), H156 (≠ K152), I157 (= I153), D176 (= D172), I177 (≠ P173), V207 (≠ L204), P208 (= P205), N213 (≠ S210), C234 (≠ T231), S235 (= S232), H297 (= H294)
Sites not aligning to the query:
P30901 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus helveticus (Lactobacillus suntoryeus) (see paper)
35% identity, 98% coverage: 2:324/330 of query aligns to 3:326/337 of P30901
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
34% identity, 97% coverage: 1:321/330 of query aligns to 1:321/334 of 3kb6B
- active site: S97 (= S99), R231 (= R233), D255 (= D257), E260 (= E262), H294 (= H294)
- binding lactic acid: F49 (= F49), S72 (= S74), V73 (≠ A75), G74 (= G76), Y96 (= Y98), R231 (= R233), H294 (= H294)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ A75), Y96 (= Y98), V101 (≠ I103), G150 (= G151), R151 (≠ K152), I152 (= I153), D171 (= D172), V172 (≠ P173), P203 (= P205), T229 (= T231), A230 (≠ S232), R231 (= R233), H294 (= H294), A296 (= A296), Y297 (≠ F297)
P26297 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14) (see 2 papers)
35% identity, 95% coverage: 2:316/330 of query aligns to 3:318/333 of P26297
- HI 156:157 (≠ KI 152:153) binding
- D176 (= D172) binding
- H206 (= H203) mutation to Q: Increase of activity.
- VP 207:208 (≠ LP 204:205) binding
- N213 (≠ S210) binding
- R236 (= R233) mutation to K: Decrease of activity.
- D260 (= D257) binding ; mutation to N: Decrease of activity.
- E265 (= E262) mutation to Q: Decrease of activity.
- H297 (= H294) mutation to Q: 90% loss of activity.
1j49A Insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus (see paper)
35% identity, 95% coverage: 2:316/330 of query aligns to 3:318/332 of 1j49A
- active site: S103 (= S99), R236 (= R233), D260 (= D257), E265 (= E262), H297 (= H294)
- binding nicotinamide-adenine-dinucleotide: Y102 (= Y98), I107 (= I103), G153 (= G149), G155 (= G151), I157 (= I153), Y175 (= Y171), D176 (= D172), I177 (≠ P173), V207 (≠ L204), P208 (= P205), N213 (≠ S210), V234 (≠ T231), S235 (= S232), R236 (= R233), H297 (= H294), A299 (= A296), F300 (= F297)
1dxyA Structure of d-2-hydroxyisocaproate dehydrogenase (see paper)
32% identity, 93% coverage: 1:306/330 of query aligns to 1:307/330 of 1dxyA
- active site: S101 (= S99), R234 (= R233), D258 (= D257), E263 (= E262), H295 (= H294)
- binding 2-oxo-4-methylpentanoic acid: V77 (≠ A75), Y100 (= Y98), Y298 (≠ F297)
- binding nicotinamide-adenine-dinucleotide: Y100 (= Y98), G152 (= G149), G154 (= G151), H155 (≠ K152), I156 (= I153), Y174 (= Y171), D175 (= D172), P176 (= P173), H204 (= H203), V205 (≠ L204), P206 (= P205), N211 (≠ S210), T232 (= T231), A233 (≠ S232), R234 (= R233), H295 (= H294), Y298 (≠ F297)
P17584 D-2-hydroxyisocaproate dehydrogenase; D-HICDH; EC 1.1.1.- from Lacticaseibacillus paracasei (Lactobacillus paracasei) (see paper)
32% identity, 93% coverage: 1:306/330 of query aligns to 1:307/333 of P17584
4prlA Crystal structure of d-lactate dehydrogenase with NAD+ from lactobacillus jensenii (see paper)
35% identity, 98% coverage: 1:323/330 of query aligns to 1:324/330 of 4prlA
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y98), I106 (= I103), V154 (≠ T150), G155 (= G151), H156 (≠ K152), I157 (= I153), Y175 (= Y171), D176 (= D172), H205 (= H203), T206 (≠ L204), P207 (= P205), A233 (≠ T231), A234 (≠ S232), D259 (= D257), H295 (= H294), A297 (= A296)
2yq5C Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. Bulgaricus: NAD complexed form (see paper)
34% identity, 93% coverage: 2:309/330 of query aligns to 2:312/331 of 2yq5C
- active site: S102 (= S99), R236 (= R233), D260 (= D257), E265 (= E262), H297 (= H294)
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y98), I106 (= I103), V155 (≠ T150), G156 (= G151), H157 (≠ K152), I158 (= I153), Y176 (= Y171), D177 (= D172), V178 (≠ P173), H206 (= H203), T207 (≠ L204), P208 (= P205), A235 (≠ S232), R236 (= R233), H297 (= H294), F300 (= F297)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
37% identity, 83% coverage: 37:309/330 of query aligns to 36:292/304 of 1wwkA
- active site: S96 (= S99), R230 (= R233), D254 (= D257), E259 (= E262), H278 (= H294)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ I103), G146 (= G149), F147 (≠ T150), G148 (= G151), R149 (≠ K152), I150 (= I153), Y168 (= Y171), D169 (= D172), P170 (= P173), V201 (≠ L204), P202 (= P205), T207 (≠ S210), T228 (= T231), S229 (= S232), D254 (= D257), H278 (= H294), G280 (≠ A296)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
32% identity, 85% coverage: 44:324/330 of query aligns to 47:318/334 of 5aovA
- active site: L100 (≠ S99), R241 (= R233), D265 (= D257), E270 (= E262), H288 (= H294)
- binding glyoxylic acid: M52 (≠ F49), L53 (≠ V50), L53 (≠ V50), Y74 (≠ R73), A75 (≠ S74), V76 (≠ A75), G77 (= G76), R241 (= R233), H288 (= H294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A75), T104 (≠ I103), F158 (≠ T150), G159 (= G151), R160 (≠ K152), I161 (= I153), S180 (≠ D172), R181 (≠ P173), A211 (≠ H203), V212 (≠ L204), P213 (= P205), T218 (≠ S210), I239 (≠ T231), A240 (≠ S232), R241 (= R233), H288 (= H294), G290 (≠ A296)
4xkjA A novel d-lactate dehydrogenase from sporolactobacillus sp
32% identity, 99% coverage: 1:327/330 of query aligns to 1:328/332 of 4xkjA
- active site: S102 (= S99), R234 (= R233), D258 (= D257), E263 (= E262), H295 (= H294)
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y98), V106 (≠ I103), G152 (= G149), G154 (= G151), R155 (≠ K152), I156 (= I153), D175 (= D172), I176 (= I175), R179 (≠ S178), H204 (= H203), V205 (≠ L204), P206 (= P205), T211 (≠ S210), A232 (≠ T231), R234 (= R233), H295 (= H294), G297 (≠ A296), F298 (= F297)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
32% identity, 85% coverage: 44:324/330 of query aligns to 46:317/332 of 6biiA
- active site: L99 (≠ S99), R240 (= R233), D264 (= D257), E269 (= E262), H287 (= H294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ A75), T103 (≠ I103), G156 (= G149), F157 (≠ T150), G158 (= G151), R159 (≠ K152), I160 (= I153), A179 (≠ N176), R180 (≠ E177), S181 (= S178), K183 (= K180), V211 (≠ L204), P212 (= P205), E216 (≠ S209), T217 (≠ S210), V238 (≠ T231), A239 (≠ S232), R240 (= R233), D264 (= D257), H287 (= H294), G289 (≠ A296)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
29% identity, 75% coverage: 60:307/330 of query aligns to 54:282/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ K152), Y160 (= Y171), D161 (= D172), P162 (= P173), I164 (= I175), L179 (≠ F190), T193 (≠ L204), P194 (= P205), S198 (= S209), L202 (≠ M213)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
29% identity, 75% coverage: 60:307/330 of query aligns to 64:292/305 of 6plfA
Query Sequence
>Echvi_3936 FitnessBrowser__Cola:Echvi_3936
MKITAFSAHKFEHSYLKEALSDHELKLLEVRLTMDTVDLAAGSDAVAIFVTDNGSRPVLE
KLQQFGVKYLALRSAGFNHVDLSAAEELGLKVARVPEYSPAAIAEHTVALMLALNRKLVK
AHNRVRDLNFSLDGLVGFDMEGKTIGIAGTGKIGSKVAKTLSGFGCRLLAYDPYINESLK
AELEIEYVDFKTLCTESDIITLHLPLSSSSQYMINSSSMEDMKKGVMLINTSRGALVNTK
EVIEALKTGKIGSFGMDVYEEEEDLFFEDHSEDILQDDVIARLLTFQNVLITSHQAFLTK
EALEKIAGVTAFNLNCWAKNESSPHELKGG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory