Comparing Echvi_3952 FitnessBrowser__Cola:Echvi_3952 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1eyyA Crystal structure of the NADP+ dependent aldehyde dehydrogenase from vibrio harveyi. (see paper)
47% identity, 96% coverage: 17:475/478 of query aligns to 42:502/504 of 1eyyA
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
33% identity, 56% coverage: 3:268/478 of query aligns to 42:289/488 of 5u0mA
Sites not aligning to the query:
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
33% identity, 56% coverage: 3:268/478 of query aligns to 42:289/488 of 5u0lA
Sites not aligning to the query:
6vr6D Structure of aldh9a1 complexed with NAD+ in space group p1 (see paper)
27% identity, 63% coverage: 107:406/478 of query aligns to 145:458/493 of 6vr6D
Sites not aligning to the query:
P49189 4-trimethylaminobutyraldehyde dehydrogenase; TMABA-DH; TMABALDH; Aldehyde dehydrogenase E3 isozyme; Aldehyde dehydrogenase family 9 member A1; Formaldehyde dehydrogenase; Gamma-aminobutyraldehyde dehydrogenase; R-aminobutyraldehyde dehydrogenase; EC 1.2.1.47; EC 1.2.1.3; EC 1.2.1.46; EC 1.2.1.19 from Homo sapiens (Human) (see 2 papers)
27% identity, 63% coverage: 107:406/478 of query aligns to 146:459/494 of P49189
Sites not aligning to the query:
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
29% identity, 55% coverage: 107:371/478 of query aligns to 140:410/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
29% identity, 55% coverage: 107:371/478 of query aligns to 140:410/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
29% identity, 55% coverage: 107:371/478 of query aligns to 140:410/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
29% identity, 55% coverage: 107:371/478 of query aligns to 140:410/488 of 8vqwC
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
29% identity, 55% coverage: 107:371/478 of query aligns to 140:410/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
29% identity, 55% coverage: 107:371/478 of query aligns to 140:410/488 of 8uzoA
8uznA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (amp bound)
29% identity, 55% coverage: 107:371/478 of query aligns to 140:410/488 of 8uznA
8uzmA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADPH bound)
29% identity, 55% coverage: 107:371/478 of query aligns to 140:410/488 of 8uzmA
8uzkA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADP+ bound)
29% identity, 55% coverage: 107:371/478 of query aligns to 140:410/488 of 8uzkA
8skfA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (lattice translocation disorder)
29% identity, 55% coverage: 107:371/478 of query aligns to 149:419/497 of 8skfA
Sites not aligning to the query:
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
26% identity, 81% coverage: 2:388/478 of query aligns to 40:419/486 of 3ju8A
Sites not aligning to the query:
2w8rA The crystal structure of human ssadh in complex with NAD+ (see paper)
28% identity, 72% coverage: 14:359/478 of query aligns to 59:401/485 of 2w8rA
Sites not aligning to the query:
2w8qA The crystal structure of human ssadh in complex with ssa. (see paper)
28% identity, 72% coverage: 14:359/478 of query aligns to 59:401/485 of 2w8qA
Sites not aligning to the query:
P51649 Succinate-semialdehyde dehydrogenase, mitochondrial; Aldehyde dehydrogenase family 5 member A1; NAD(+)-dependent succinic semialdehyde dehydrogenase; EC 1.2.1.24 from Homo sapiens (Human) (see 5 papers)
28% identity, 72% coverage: 14:359/478 of query aligns to 109:451/535 of P51649
Sites not aligning to the query:
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
26% identity, 80% coverage: 2:382/478 of query aligns to 46:427/487 of Q9H2A2
Sites not aligning to the query:
>Echvi_3952 FitnessBrowser__Cola:Echvi_3952
MQLDKVVYQSEAAFEQYKITSLAERAAFLRKIADQLEAIKEALIPTACEESHLPEGRITG
ELGRTTGQIRLFAKYVEEGTWLEVTIDHGDPERTPAPKPDLRRMLVPLGPVAVFGASNFP
LAFSTAGGDSISALAAGCTVVYKGHPGHPKTSLMVFEAIQQAIAAAGLPEGVFQHVEGGI
SEGQTLVQHPAIKAVGFTGSFKGGKALFDLANSRPEPIPVYAEMGSINPIIAFESALANS
EQVAGQYAQSLTLGAGQFCTNPGVIFVPADMAEAFAQNTGKVLADAAGQAMLHEGIQTAY
HQSLDHLADTGGLKWIQKAAAKDAGHPALALTDLDTWIKSPSLQEEVFGPFGIVVAYDSI
AALLKAAKTLQGQLTITLWASESELTDQAALINTLQDKCGRLLFGGVPTGVEVGHAMQHG
GPFPATTDSRSTSVGVYAIKRFARPFAYQNCPDGLLPKELKEANPLDIIRTVDGEVVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory