Comparing Echvi_3953 FitnessBrowser__Cola:Echvi_3953 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
29% identity, 89% coverage: 4:272/303 of query aligns to 4:270/291 of 3na8A
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
29% identity, 90% coverage: 7:278/303 of query aligns to 6:279/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
29% identity, 90% coverage: 7:278/303 of query aligns to 6:279/296 of 7lvlA
4pfmA Shewanella benthica dhdps with lysine and pyruvate
29% identity, 67% coverage: 4:205/303 of query aligns to 4:205/295 of 4pfmA
4wozB Crystal structures of cdnal from clostridium difficile in complex with mannosamine
25% identity, 94% coverage: 2:285/303 of query aligns to 2:285/290 of 4wozB
4woqC Crystal structures of cdnal from clostridium difficile in complex with ketobutyric
25% identity, 94% coverage: 2:285/303 of query aligns to 2:285/290 of 4woqC
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
29% identity, 76% coverage: 9:239/303 of query aligns to 13:243/307 of 4fhaA
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
27% identity, 90% coverage: 3:274/303 of query aligns to 5:274/295 of Q5HG25
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
27% identity, 90% coverage: 3:274/303 of query aligns to 5:274/291 of 3di1B
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
28% identity, 96% coverage: 3:292/303 of query aligns to 2:294/294 of Q8UGL3
Q9S4K9 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Clostridium perfringens (strain 13 / Type A) (see paper)
25% identity, 88% coverage: 5:270/303 of query aligns to 3:268/288 of Q9S4K9
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
30% identity, 67% coverage: 3:205/303 of query aligns to 2:205/294 of 4i7wA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 90% coverage: 3:274/303 of query aligns to 2:273/292 of Q07607
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
26% identity, 72% coverage: 5:222/303 of query aligns to 4:218/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
26% identity, 72% coverage: 5:222/303 of query aligns to 4:218/292 of 3puoA
Sites not aligning to the query:
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
28% identity, 69% coverage: 5:213/303 of query aligns to 4:212/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
28% identity, 69% coverage: 5:213/303 of query aligns to 4:212/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
28% identity, 69% coverage: 5:213/303 of query aligns to 4:212/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
28% identity, 69% coverage: 5:213/303 of query aligns to 4:212/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
28% identity, 69% coverage: 5:213/303 of query aligns to 4:212/291 of 3rk8A
Sites not aligning to the query:
>Echvi_3953 FitnessBrowser__Cola:Echvi_3953
MNWNGVFPAVTTKFHGDGSIDYDTFFLNLEAQIDAGVSGVILGGTLGESSVLEDEEKIEL
TKKTKEKIAGRVPVVLNIAEGSTAKAIYWAKKAEELGLDALMLLPPMRYPSDHRETVTYF
KTVAQATHLPIMIYNNPVDYKTYVTLEMFDELMECENIQAVKESTRDVSNVTRMKTRFGD
RYKILCGVDTLTMESVLMGADGLVAGLVCAFPKETVVLFDLCKERRIEEALPIYQWFLPL
LELDIHPKLVQYIKLAEQMAGIGTENVRAPRLTLIGEERARVEKLIQTGLENRPELAEIK
TSI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory