Comparing Echvi_3959 FitnessBrowser__Cola:Echvi_3959 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
42% identity, 92% coverage: 6:268/286 of query aligns to 4:270/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
42% identity, 92% coverage: 6:268/286 of query aligns to 4:270/292 of 3puoA
Sites not aligning to the query:
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
38% identity, 97% coverage: 4:280/286 of query aligns to 2:283/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
38% identity, 97% coverage: 4:280/286 of query aligns to 2:283/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
38% identity, 97% coverage: 4:280/286 of query aligns to 3:284/293 of 5t25A
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
38% identity, 97% coverage: 4:280/286 of query aligns to 2:283/292 of 3i7sA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
39% identity, 96% coverage: 6:280/286 of query aligns to 4:282/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
39% identity, 96% coverage: 6:280/286 of query aligns to 4:282/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
39% identity, 96% coverage: 6:280/286 of query aligns to 4:282/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
39% identity, 96% coverage: 6:280/286 of query aligns to 4:282/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
39% identity, 96% coverage: 6:280/286 of query aligns to 4:282/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
39% identity, 96% coverage: 6:280/286 of query aligns to 4:282/291 of 3pueB
4pfmA Shewanella benthica dhdps with lysine and pyruvate
41% identity, 92% coverage: 6:268/286 of query aligns to 5:272/295 of 4pfmA
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
37% identity, 94% coverage: 10:279/286 of query aligns to 13:286/307 of 4fhaA
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
37% identity, 95% coverage: 10:280/286 of query aligns to 11:286/295 of 5ktlA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
39% identity, 97% coverage: 4:281/286 of query aligns to 2:283/292 of Q07607
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
35% identity, 94% coverage: 4:273/286 of query aligns to 3:279/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
35% identity, 94% coverage: 4:273/286 of query aligns to 2:278/294 of Q9X1K9
5ud6C Crystal structure of dhdps from cyanidioschyzon merolae with lysine bound
37% identity, 98% coverage: 2:281/286 of query aligns to 1:290/299 of 5ud6C
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
36% identity, 98% coverage: 5:285/286 of query aligns to 5:290/296 of 7kg2A
>Echvi_3959 FitnessBrowser__Cola:Echvi_3959
MEQFIGTGVALVTPFDEEGNIDYNGLDKVIEHVIQGGADYLVVMGTTGEASTMSRKEKHD
ILAAAVKTNNGRLPIVYGIGANNTQAAIDEIDETDLSGVAALLSVSPYYNKPTQEGIYQH
YIKVADASPVPIILYNVPGRTMSNITAATTLRLSEHPKIIGVKEASGDMVQCMDIIRKKP
SDFLLISGDDMLTTSLKAIGGHGAISVLANAYPDIFKTICHGSAEESLAATFRLLDINAW
MYVESNPVGVKNLLKHMGVCGDQVRLPLLRATESLDKKIKELAAKV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory