Comparing Echvi_3961 FitnessBrowser__Cola:Echvi_3961 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7u7hA Cysteate acyl-acp transferase from alistipes finegoldii (see paper)
64% identity, 97% coverage: 1:405/416 of query aligns to 2:407/423 of 7u7hA
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
34% identity, 88% coverage: 24:390/416 of query aligns to 24:382/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
34% identity, 88% coverage: 24:390/416 of query aligns to 24:382/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
34% identity, 88% coverage: 24:390/416 of query aligns to 24:382/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
34% identity, 88% coverage: 24:390/416 of query aligns to 24:382/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
34% identity, 88% coverage: 24:390/416 of query aligns to 24:382/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
34% identity, 88% coverage: 24:390/416 of query aligns to 24:382/394 of 8guhA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
34% identity, 88% coverage: 24:390/416 of query aligns to 24:382/392 of 3a2bA
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
34% identity, 85% coverage: 42:393/416 of query aligns to 43:389/400 of 7v58B
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
34% identity, 83% coverage: 44:388/416 of query aligns to 286:622/653 of Q5W264
Sites not aligning to the query:
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
34% identity, 86% coverage: 42:400/416 of query aligns to 44:397/401 of 1fc4A
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
34% identity, 86% coverage: 42:400/416 of query aligns to 41:394/398 of P0AB77
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
35% identity, 91% coverage: 22:400/416 of query aligns to 22:394/398 of 7poaA
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
31% identity, 87% coverage: 38:400/416 of query aligns to 35:393/396 of 3tqxA
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
31% identity, 84% coverage: 45:393/416 of query aligns to 67:408/419 of Q0P5L8
Sites not aligning to the query:
Q93UV0 Serine palmitoyltransferase; SPT; EC 2.3.1.50 from Sphingomonas paucimobilis (Pseudomonas paucimobilis) (see 4 papers)
29% identity, 86% coverage: 40:395/416 of query aligns to 62:411/420 of Q93UV0
Sites not aligning to the query:
2xbnA Inhibition of the plp-dependent enzyme serine palmitoyltransferase by cycloserine: evidence for a novel decarboxylative mechanism of inactivation (see paper)
29% identity, 86% coverage: 40:395/416 of query aligns to 41:390/398 of 2xbnA
2w8jA Spt with plp-ser (see paper)
29% identity, 86% coverage: 40:395/416 of query aligns to 41:390/398 of 2w8jA
Sites not aligning to the query:
4bmkA Serine palmitoyltransferase k265a from s. Paucimobilis with bound plp- myriocin aldimine (see paper)
29% identity, 86% coverage: 40:395/416 of query aligns to 41:390/398 of 4bmkA
2x8uA Sphingomonas wittichii serine palmitoyltransferase (see paper)
29% identity, 86% coverage: 40:395/416 of query aligns to 41:390/399 of 2x8uA
>Echvi_3961 FitnessBrowser__Cola:Echvi_3961
MDIFEKLNTNLGPLGKHSDLSEGYFMFPKLEGEIAPRMKFKGEEVLTWSLNNYLGLANHP
EIRKADAEAAKRWGAAYPMGARMMSGNTDMHEQLENELAAFVGKEKAYLLNYGYQGIMSV
IDSLVDRKDVIVYDSECHASIIDGLRMHMGKRFVYPHNDMESFEKQLIRAEKLTNETGGG
ILVITEGVFGMTGNMGDLKGIVKYKEKYQFRLVVDDAHGFGTMGPTGAGAGEAQGVQDQV
DLYFSTFAKSMAGIGAFVAGDTKVVHYLKYNMRSQIFAKALPMIFVEGALKRLEMIRENP
KHKERLWEVVNALQNGLKEKGFSIGTTTTPVTPVVLNGTVGEAATLSKDLRENYNIFCSV
VIYPVVPKGMIILRLIPTAAHTLEDVSETIIAFEAIKDKLTSGYYKTTELATSFGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory