SitesBLAST
Comparing Echvi_4005 FitnessBrowser__Cola:Echvi_4005 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
59% identity, 97% coverage: 5:257/262 of query aligns to 7:252/254 of 3o03A
- active site: G22 (= G20), S147 (= S145), V157 (= V155), Y160 (= Y158), K164 (= K162)
- binding calcium ion: S147 (= S145), M148 (= M146), P190 (= P188)
- binding D-gluconic acid: I99 (= I97), R101 (= R99), S147 (= S145), M149 (= M147), R154 (= R152), Y160 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G16), Y21 (≠ H19), G22 (= G20), I23 (≠ L21), D42 (≠ G40), I43 (≠ H41), L47 (≠ K45), D68 (= D66), V69 (= V67), N95 (= N93), A96 (= A94), G97 (= G95), I145 (= I143), Y160 (= Y158), K164 (= K162), P190 (= P188)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
42% identity, 97% coverage: 3:255/262 of query aligns to 10:261/261 of 5u9pB
- active site: G27 (= G20), S152 (= S145), Y165 (= Y158), K169 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G16), R26 (≠ H19), G27 (= G20), I28 (≠ L21), R48 (≠ H41), D73 (= D66), V74 (= V67), N100 (= N93), A101 (= A94), I150 (= I143), Y165 (= Y158), K169 (= K162), P195 (= P188), F198 (= F191), T200 (= T193), L202 (≠ Q195), N203 (≠ T196)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
38% identity, 96% coverage: 4:254/262 of query aligns to 1:252/252 of 1vl8B
- active site: G17 (= G20), S143 (= S145), I154 (≠ V155), Y157 (= Y158), K161 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (≠ H19), G17 (= G20), L18 (= L21), S37 (≠ G40), R38 (≠ H41), C63 (≠ F65), D64 (= D66), V65 (= V67), A91 (≠ N93), A92 (= A94), G93 (= G95), I94 (≠ M96), V114 (≠ M116), I141 (= I143), S143 (= S145), Y157 (= Y158), K161 (= K162), P187 (= P188), G188 (= G189), Y190 (≠ F191), T192 (= T193), M194 (≠ Q195), T195 (= T196)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
43% identity, 95% coverage: 5:253/262 of query aligns to 6:246/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), D19 (≠ T18), L22 (= L21), I42 (≠ P43), D65 (= D66), M66 (≠ V67), N92 (= N93), A93 (= A94), G94 (= G95), L115 (≠ M116), I143 (= I143), S145 (= S145), Y158 (= Y158), K162 (= K162), G189 (= G189), M191 (≠ F191), T193 (= T193), N195 (≠ Q195)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
40% identity, 95% coverage: 5:254/262 of query aligns to 3:249/249 of 3uf0A
- active site: G18 (= G20), S141 (= S145), V151 (= V155), Y154 (= Y158), K158 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S17 (≠ H19), G18 (= G20), I19 (≠ L21), R39 (≠ H41), D63 (= D66), L64 (≠ V67), N89 (= N93), G91 (= G95), I92 (≠ M96), I139 (= I143), A140 (≠ C144), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), V187 (≠ F191), T189 (= T193), N191 (≠ Q195), T192 (= T196)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
40% identity, 96% coverage: 2:253/262 of query aligns to 1:245/246 of 4hp8B
- active site: G19 (= G20), S138 (= S145), V148 (= V155), Y151 (= Y158), K155 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), N17 (≠ T18), T18 (≠ H19), G19 (= G20), L20 (= L21), R40 (≠ H41), R41 (≠ T42), D63 (= D66), F64 (≠ V67), N85 (= N93), G87 (= G95), I88 (≠ M96), I136 (= I143), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189), I184 (≠ F191), T186 (= T193), N188 (≠ Q195), T189 (= T196)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 95% coverage: 3:251/262 of query aligns to 2:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ T18), R18 (≠ H19), I20 (≠ L21), T40 (= T42), N62 (≠ D66), V63 (= V67), N89 (= N93), A90 (= A94), I92 (≠ M96), V139 (≠ I143), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), I187 (≠ F191), T189 (= T193), M191 (≠ Q195)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
35% identity, 95% coverage: 3:251/262 of query aligns to 2:240/243 of 4i08A
- active site: G19 (= G20), N113 (≠ D117), S141 (= S145), Q151 (≠ V155), Y154 (= Y158), K158 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ T18), R18 (≠ H19), I20 (≠ L21), T40 (= T42), N62 (≠ D66), V63 (= V67), N89 (= N93), A90 (= A94), G140 (≠ C144), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), T189 (= T193)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
37% identity, 94% coverage: 7:252/262 of query aligns to 4:245/247 of P73574
- A14 (= A17) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ N153) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K162) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ Y190) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ D202) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
36% identity, 95% coverage: 5:254/262 of query aligns to 8:254/254 of 4ag3A
- active site: G23 (= G20), S148 (= S145), Y161 (= Y158), K165 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G16), S21 (≠ T18), R22 (≠ H19), G23 (= G20), I24 (≠ L21), T44 (≠ H41), L68 (≠ F65), D69 (= D66), V70 (= V67), N96 (= N93), A97 (= A94), I146 (= I143), S148 (= S145), Y161 (= Y158), K165 (= K162), P191 (= P188), G192 (= G189), F193 (≠ Y190), I194 (≠ F191), T196 (= T193), M198 (≠ Q195), T199 (= T196)
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
33% identity, 95% coverage: 1:250/262 of query aligns to 3:252/257 of 5fffA
- active site: K206 (≠ G203)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ I97), H158 (≠ V155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G16), T20 (= T18), G22 (= G20), I23 (≠ L21), R43 (≠ H41), C67 (≠ F65), D68 (= D66), V69 (= V67), N96 (= N93), I146 (= I143), Y161 (= Y158), K165 (= K162), P191 (= P188), A193 (≠ Y190), I194 (≠ F191), T196 (= T193), G198 (≠ Q195), T199 (= T196)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
33% identity, 95% coverage: 1:250/262 of query aligns to 3:252/257 of 5ff9B
- active site: K206 (≠ G203)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ I97), I155 (≠ R152), H158 (≠ V155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G16), T20 (= T18), K21 (≠ H19), I23 (≠ L21), S42 (≠ G40), R43 (≠ H41), C67 (≠ F65), D68 (= D66), V69 (= V67), N96 (= N93), I146 (= I143), S148 (= S145), Y161 (= Y158), K165 (= K162), P191 (= P188), A193 (≠ Y190), I194 (≠ F191), T196 (= T193), G198 (≠ Q195), T199 (= T196)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
33% identity, 95% coverage: 1:250/262 of query aligns to 3:252/257 of A0A1A9TAK5
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 94% coverage: 7:252/262 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G20), S142 (= S145), Q152 (≠ V155), Y155 (= Y158), K159 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ T18), R15 (≠ H19), G16 (= G20), I17 (≠ L21), N35 (= N39), Y36 (≠ G40), N37 (≠ H41), G38 (vs. gap), S39 (≠ T42), N63 (≠ D66), V64 (= V67), N90 (= N93), A91 (= A94), I93 (≠ M96), I113 (≠ M116), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), I188 (≠ F191), T190 (= T193)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 94% coverage: 5:251/262 of query aligns to 1:241/244 of P0AEK2
- GASR 12:15 (≠ GATH 16:19) binding
- T37 (= T42) binding
- NV 59:60 (≠ DV 66:67) binding
- N86 (= N93) binding
- Y151 (= Y158) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (= YAAAK 158:162) binding
- A154 (= A161) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K162) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ F191) binding
- E233 (≠ Q243) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
35% identity, 94% coverage: 6:251/262 of query aligns to 1:240/243 of 1q7bA
- active site: G15 (= G20), E101 (≠ D109), S137 (= S145), Q147 (≠ V155), Y150 (= Y158), K154 (= K162)
- binding calcium ion: E232 (≠ Q243), T233 (≠ I244)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ T18), R14 (≠ H19), T36 (= T42), N58 (≠ D66), V59 (= V67), N85 (= N93), A86 (= A94), G87 (= G95), I88 (≠ M96), S137 (= S145), Y150 (= Y158), K154 (= K162), P180 (= P188), G181 (= G189), I183 (≠ F191)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 94% coverage: 7:252/262 of query aligns to 5:243/244 of 4nbuB
- active site: G18 (= G20), N111 (≠ D117), S139 (= S145), Q149 (≠ V155), Y152 (= Y158), K156 (= K162)
- binding acetoacetyl-coenzyme a: D93 (≠ R99), K98 (≠ E104), S139 (= S145), N146 (≠ R152), V147 (≠ N153), Q149 (≠ V155), Y152 (= Y158), F184 (≠ Y190), M189 (≠ Q195), K200 (≠ F209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), N17 (≠ H19), G18 (= G20), I19 (≠ L21), D38 (≠ G40), F39 (≠ H41), V59 (vs. gap), D60 (= D66), V61 (= V67), N87 (= N93), A88 (= A94), G89 (= G95), I90 (≠ M96), T137 (≠ I143), S139 (= S145), Y152 (= Y158), K156 (= K162), P182 (= P188), F184 (≠ Y190), T185 (≠ F191), T187 (= T193), M189 (≠ Q195)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
33% identity, 92% coverage: 10:251/262 of query aligns to 6:241/244 of 6t62A
- active site: G16 (= G20), S138 (= S145), Y151 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ T18), R15 (≠ H19), A36 (≠ G40), T37 (≠ H41), L58 (≠ F65), D59 (= D66), V60 (= V67), N86 (= N93), A87 (= A94), G88 (= G95), I89 (≠ M96), I136 (= I143), S137 (≠ C144), S138 (= S145), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189), I184 (≠ F191), M188 (≠ Q195)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
33% identity, 92% coverage: 10:251/262 of query aligns to 6:241/244 of 6wprA
- active site: G16 (= G20), S138 (= S145), Y151 (= Y158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ T18), R15 (≠ H19), T37 (≠ H41), L58 (≠ F65), D59 (= D66), V60 (= V67), N86 (= N93), A87 (= A94), G88 (= G95), I89 (≠ M96), I136 (= I143), Y151 (= Y158), K155 (= K162), P181 (= P188)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 93% coverage: 7:250/262 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ H19) binding
- D36 (≠ G40) binding
- D62 (= D66) binding
- I63 (≠ V67) binding
- N89 (= N93) binding
- Y153 (= Y158) binding
- K157 (= K162) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>Echvi_4005 FitnessBrowser__Cola:Echvi_4005
MKELFDLSGKVALVTGATHGLGMAMAKALAKSGATLIVNGHTPAKMEKALEEYAADGIEA
HGYLFDVTNEKEVDEKLSEIEGKFGTVDILVNNAGMIQRTPAMEMEVADFAKVVNMDLVS
PFLMSKRVAKGMKEKGGGKIINICSMMSELGRNTVSGYAAAKGGLKMLTRNLATEWAKYN
IQVNGIGPGYFATEQTAPIRVDGHPFNDFIINRTPAGRWGDPEDLQGTMVFLASQASNFV
NGQIVYVDGGILASIGKPHGEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory