Comparing Echvi_4033 FitnessBrowser__Cola:Echvi_4033 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
35% identity, 98% coverage: 6:361/362 of query aligns to 4:362/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
35% identity, 98% coverage: 6:361/362 of query aligns to 2:360/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
32% identity, 98% coverage: 6:361/362 of query aligns to 2:320/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
31% identity, 98% coverage: 6:361/362 of query aligns to 2:318/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
35% identity, 59% coverage: 9:223/362 of query aligns to 3:205/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
31% identity, 70% coverage: 4:256/362 of query aligns to 10:256/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
31% identity, 70% coverage: 4:256/362 of query aligns to 10:234/236 of 7f5xA
>Echvi_4033 FitnessBrowser__Cola:Echvi_4033
MIHRKANTIVIKIGSNVLTQADGTPDTMRMKALVRQMVYLREQGQEIVLITSGAVAYGRT
STVFEEKTDPVIQKQILAAVGQIELIRQYKQLFGDHNTPIAQIMVTKSDFRDRKHFLNMK
NCLEGLLKNNIIPVINENDTVSVTELMFTDNDELAGLVAAMLDAKDLIILSNVEGIFKGH
PSDPEAVLIEKVDADTPSMANFISSSKSSFGRGGMLTKMNMAKKSADLGIGVTIANGKRE
DVLVDYFHNRLRCTYFEPSKAKQSPKKWIAHSEHYSTGEVIINSGAENALRSDKITSLLP
IGVLEIRGDFSKGDIIRILSEDGRKIGLGKSAYGAKVAAEKKGLSNQKPLIHYDYLYLHQ
DS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory