Comparing Echvi_4038 FitnessBrowser__Cola:Echvi_4038 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5jovA Bacteroides ovatus xyloglucan pul gh31 with bound 5fidof (see paper)
50% identity, 97% coverage: 31:952/955 of query aligns to 26:949/949 of 5jovA
7kncA Crystal structure of the gh31 alpha-xylosidase (xac1773) from xanthomonas citri
48% identity, 96% coverage: 31:950/955 of query aligns to 6:916/919 of 7kncA
2xvlA Crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus in complex with pentaerythritol propoxylate (5 4 po oh) (see paper)
46% identity, 96% coverage: 32:951/955 of query aligns to 11:941/944 of 2xvlA
2xvkA Crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus in complex with 5-fluoro-alpha-d-xylopyranosyl fluoride (see paper)
46% identity, 96% coverage: 32:951/955 of query aligns to 11:941/944 of 2xvkA
5zn7A Crystal structure of gh31 alpha-xylosidase from a soil metagenome complexed with xylose
35% identity, 49% coverage: 375:840/955 of query aligns to 210:671/680 of 5zn7A
6jr7A Flavobacterium johnsoniae gh31 dextranase, fjdex31a, complexed with glucose (see paper)
31% identity, 57% coverage: 363:911/955 of query aligns to 197:736/812 of 6jr7A
B3PEE6 Oligosaccharide 4-alpha-D-glucosyltransferase; Alpha-glucosidase 31B; CJAgd31B; EC 2.4.1.161 from Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa) (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 234:766/816 of B3PEE6
5i24A Crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf021 (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 196:728/779 of 5i24A
5i23A Crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf022 (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 196:728/779 of 5i23A
7p4dAAA Oligosaccharide 4-alpha-D-glucosyltransferase (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 197:729/780 of 7p4dAAA
Sites not aligning to the query:
7p4cAAA Oligosaccharide 4-alpha-D-glucosyltransferase (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 197:729/780 of 7p4cAAA
Sites not aligning to the query:
5npeA Crystal structure of cjagd31b (alpha-transglucosylase from glycoside hydrolase family 31) in complex with beta cyclophellitol aziridine probe ky358 (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 197:729/780 of 5npeA
Sites not aligning to the query:
5npbA Crystal structure of cjagd31b (alpha-transglucosylase from glycoside hydrolase family 31) in complex with alpha cyclophellitol cyclosulfate probe me647 (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 197:729/780 of 5npbA
Sites not aligning to the query:
4b9zA Crystal structure of agd31b, alpha-transglucosylase, complexed with acarbose (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 197:729/780 of 4b9zA
Sites not aligning to the query:
4b9yA Crystal structure of apo agd31b, alpha-transglucosylase in glycoside hydrolase family 31 (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 197:729/780 of 4b9yA
Sites not aligning to the query:
8rw3A Crystal structure of agd31b, alpha-transglucosylase, complexed with a non-covalent 1,2- cyclophellitol aziridine (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 198:730/781 of 8rw3A
4ba0A Crystal structure of agd31b, alpha-transglucosylase, complexed with 5f-alpha-glcf (see paper)
30% identity, 57% coverage: 379:927/955 of query aligns to 198:730/781 of 4ba0A
Sites not aligning to the query:
5npdA Crystal structure of d412n nucleophile mutant cjagd31b (alpha- transglucosylase from glycoside hydrolase family 31) in complex with alpha cyclophellitol aziridine probe cf021 (see paper)
29% identity, 57% coverage: 379:927/955 of query aligns to 197:729/780 of 5npdA
Sites not aligning to the query:
5npcA Crystal structure of d412n nucleophile mutant cjagd31b (alpha- transglucosylase from glycoside hydrolase family 31) in complex with unreacted alpha cyclophellitol cyclosulfate probe me647 (see paper)
29% identity, 57% coverage: 379:927/955 of query aligns to 197:729/780 of 5npcA
Sites not aligning to the query:
6druA Xylosidase from aspergillus niger (see paper)
31% identity, 49% coverage: 369:833/955 of query aligns to 208:704/718 of 6druA
Sites not aligning to the query:
>Echvi_4038 FitnessBrowser__Cola:Echvi_4038
MSLTKLIYTFVMLVLLYACAPSAGENFPPENGITITLPSDDPYSPKQVRLEVITENIIRV
TSSPLDTRPVNSSLMIIDQLPSPPAWEKTETADSVGLQTAKVQAWISKSTGEVTFKDASG
KLILQEAKAGKAFGPPADDLEDDAVFSIQQRFKSPENEAFYGLGQQQTGLFNYKGYHVDL
TQYNSVVAVPFMVSSRNYGILWDNYSITKFGDDREPMPLSELRLFDANGKEGFLTATYAN
DPNRPNEGLKEQEGHIAYTFLDDLNKIPKDFDMANGTATWQGSLQARESGVHRFHMTYSG
YVKVWADGQLLVDRWRESWNPGPLVFELPLDTEKATAFKIEWIPESTQSFLSVKFLPPDR
YRTTETYAFRSEAGKMLDYYFVAGQDMDELISGYRQLTGKAQIMPKWAMGFWQSRERYKT
QEELLSTVAEYRKRHIPLDNIVQDWSYWPEDAWGSHDFDPARFPDPVGMIDQVHDQYHAH
IMISVWPKFYEGIEHYKQFDEKGWLYKQNILNRQRDWIGEGYISTFYDAFNPGARELFWK
QINEKLYQKGIDAWWLDATEPDVLSNASIQHRKTLMNPTALGTATEYFNGYPLVNAKGIY
HGQRATNPDDRVFILTRSAFPGIQRYGAATWSGDISARFDELEQQIPAGLNFSLSGLPYW
TTDIGGFFVEDKYDRPDPKGEALEEWRELNTRWYQYGTFTPLYRSHGQYPYREVFNIAPE
GHPAYRSIVFYNKLRYRLMPYIYSLTGKVHHDDYTIMRPLIMDFDHDPRVGQIKDQFMFG
PSILVNPVYHYEATNRDIYFPKETGWYDLLTGEYQAGGVEKNIEAPYDKIPLFVKAGSII
PFGPKIEYTDEKPADEITLYVYAGQNGYFELYEDQGSNYEYEQGQFSIIPLTYDENTKTL
TIGAQEGEFEGMLTSRTFHVIYVQKDRPTGYKPDATTEKAIHYTGQSMALKLDEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory