Comparing Echvi_4044 FitnessBrowser__Cola:Echvi_4044 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 96% coverage: 5:242/249 of query aligns to 84:334/345 of Q9AT00
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 96% coverage: 5:242/249 of query aligns to 2:235/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 98% coverage: 4:247/249 of query aligns to 2:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 98% coverage: 4:247/249 of query aligns to 2:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 98% coverage: 4:247/249 of query aligns to 2:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 98% coverage: 4:247/249 of query aligns to 2:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 94% coverage: 8:242/249 of query aligns to 4:235/240 of 4ymuJ
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
34% identity, 93% coverage: 3:234/249 of query aligns to 2:234/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
34% identity, 93% coverage: 3:234/249 of query aligns to 2:234/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
34% identity, 92% coverage: 5:234/249 of query aligns to 2:232/253 of 6z5uK
8g4cB Bceabs atpgs high res tm (see paper)
34% identity, 87% coverage: 5:220/249 of query aligns to 3:220/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
34% identity, 87% coverage: 5:220/249 of query aligns to 2:219/245 of 7tchB
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
32% identity, 95% coverage: 6:242/249 of query aligns to 4:238/262 of 7chaI
1g291 Malk (see paper)
33% identity, 92% coverage: 13:242/249 of query aligns to 11:239/372 of 1g291
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 97% coverage: 5:245/249 of query aligns to 1:230/348 of 3d31A
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 95% coverage: 6:242/249 of query aligns to 7:242/375 of 2d62A
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
33% identity, 96% coverage: 4:242/249 of query aligns to 3:228/353 of 1vciA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 95% coverage: 6:242/249 of query aligns to 4:233/369 of P19566
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
32% identity, 95% coverage: 6:242/249 of query aligns to 3:232/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
32% identity, 95% coverage: 6:242/249 of query aligns to 3:232/371 of 3puxA
>Echvi_4044 FitnessBrowser__Cola:Echvi_4044
MREKVVEVRGLKKSFGELDVLMGVDLDLYKGENVVVLGKSGTGKSVLIKIMVGLLTQDEG
TMNVLGKEVSNLGAKDLNELRLKIGFSFQASALYDSMTVRENLEFPLVRNVKGLSRTEKD
KMVEEVLEAVGLSQTINQMPSELSGGQRKRIGIARTLILKPEIMLYDEPTAGLDPITCSD
INNLINEVRENYNTSSIIITHDLTCARDTGDRVAVLLDGQFGAEGKFEEVFKTPEDQRVK
SFYDYNFIT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory