Comparing Echvi_4056 FitnessBrowser__Cola:Echvi_4056 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
58% identity, 87% coverage: 38:320/327 of query aligns to 47:332/340 of Q47898
Sites not aligning to the query:
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
57% identity, 87% coverage: 38:320/327 of query aligns to 2:287/295 of 1p4vA
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
57% identity, 86% coverage: 39:320/327 of query aligns to 1:285/293 of 4r4yA
2gl9B Crystal structure of glycosylasparaginase-substrate complex (see paper)
62% identity, 40% coverage: 190:320/327 of query aligns to 2:136/144 of 2gl9B
Sites not aligning to the query:
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
35% identity, 87% coverage: 41:324/327 of query aligns to 28:342/346 of P20933
Sites not aligning to the query:
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
39% identity, 74% coverage: 58:298/327 of query aligns to 35:273/308 of Q7L266
P30919 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Rattus norvegicus (Rat) (see paper)
35% identity, 82% coverage: 33:301/327 of query aligns to 20:314/345 of P30919
Sites not aligning to the query:
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
39% identity, 74% coverage: 58:298/327 of query aligns to 36:265/300 of 4osxA
Sites not aligning to the query:
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
39% identity, 74% coverage: 58:298/327 of query aligns to 36:263/298 of 4pvrA
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
39% identity, 74% coverage: 58:298/327 of query aligns to 36:260/295 of 4o0hA
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
39% identity, 62% coverage: 97:298/327 of query aligns to 74:263/298 of 4o48A
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 73% coverage: 59:297/327 of query aligns to 41:284/321 of P37595
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
39% identity, 33% coverage: 189:297/327 of query aligns to 1:106/135 of 2zalB
1apzB Human aspartylglucosaminidase complex with reaction product (see paper)
40% identity, 35% coverage: 189:301/327 of query aligns to 1:110/141 of 1apzB
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
39% identity, 33% coverage: 189:297/327 of query aligns to 1:106/135 of 8c23DDD
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
40% identity, 34% coverage: 189:298/327 of query aligns to 1:104/133 of 2gezB
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
26% identity, 60% coverage: 53:248/327 of query aligns to 68:299/420 of Q9H6P5
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
41% identity, 29% coverage: 59:153/327 of query aligns to 39:133/166 of 2gezC
2a8jB Crystal structure of human taspase1 (acivated form) (see paper)
26% identity, 60% coverage: 53:248/327 of query aligns to 28:206/313 of 2a8jB
Sites not aligning to the query:
4pu6B Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ cations (see paper)
34% identity, 37% coverage: 189:309/327 of query aligns to 1:110/131 of 4pu6B
>Echvi_4056 FitnessBrowser__Cola:Echvi_4056
MSDRRKFLKNSLLSSTLLVPGAFRGAVDKWSGLKNGESHKPLILSTWNHGMPANDKAWEV
LEKSGNIVDAVEQGVMVTENDLKNLSVGLQGLPDREGIVTLDASIMKGDGSCGSVCFVRQ
VKHPISLARKVMEDTPHVMLAGEGARQFAIQEGFPIEKEELSPAAEKAYEKWKLKSEYKP
VINIENHDTIGMIGLDQNGNLAGSCTTSGLAYKMHGRVGDSPIIGAGLYVDNEVGAATAT
GLGESIIKICGSFLIVELMRQGRSPQEACEEAVRRLISKNKGIEGIQAGFLAVNKDGEHG
AYAVHPGFNYAMHHKEGKALVDSKSKF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory