SitesBLAST
Comparing Echvi_4178 FitnessBrowser__Cola:Echvi_4178 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vp5A Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
58% identity, 98% coverage: 3:280/283 of query aligns to 4:284/284 of 1vp5A
- active site: D44 (= D44), Y49 (= Y49), K78 (= K74), H111 (= H107)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), V20 (= V19), F21 (= F20), D44 (= D44), Y49 (= Y49), N140 (= N136), Q161 (= Q157), W187 (= W183), G188 (= G184), P189 (= P185), F190 (= F186), E192 (= E188), F198 (= F194), A215 (= A211), I230 (= I226), K232 (= K228), T233 (≠ S229), V234 (= V230), R238 (= R234), E241 (= E237), N242 (= N238)
4g5dA X-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to NADPH (see paper)
47% identity, 91% coverage: 4:261/283 of query aligns to 8:272/283 of 4g5dA
- active site: D48 (= D44), Y53 (= Y49), K78 (= K74), H111 (= H107)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G18), V23 (= V19), W24 (≠ F20), D48 (= D44), Y53 (= Y49), H111 (= H107), S148 (≠ A135), N149 (= N136), Q170 (= Q157), W196 (= W183), S197 (≠ G184), P198 (= P185), L199 (≠ F186), Q201 (≠ E188), G202 (= G189), L205 (≠ F194), I237 (= I226), P238 (= P227), K239 (= K228), S240 (= S229), V241 (= V230), H242 (= H231), R245 (= R234), E248 (= E237), N249 (= N238)
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
45% identity, 94% coverage: 4:269/283 of query aligns to 4:271/277 of 4fziA
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
45% identity, 94% coverage: 4:269/283 of query aligns to 15:282/288 of 4gieA
- active site: D55 (= D44), Y60 (= Y49), K85 (= K74), H118 (= H107)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G18), W31 (≠ F20), D55 (= D44), Y60 (= Y49), H118 (= H107), W119 (≠ Q108), N148 (= N136), Q169 (= Q157), W195 (= W183), S196 (≠ G184), P197 (= P185), L198 (≠ F186), S200 (≠ E188), L207 (≠ F194), A224 (= A211), I239 (= I226), P240 (= P227), K241 (= K228), S242 (= S229), R247 (= R234), E250 (= E237), N251 (= N238)
3d3fA Crystal structure of yvgn and cofactor NADPH from bacillus subtilis (see paper)
52% identity, 90% coverage: 4:258/283 of query aligns to 8:261/275 of 3d3fA
- active site: D48 (= D44), Y53 (= Y49), K78 (= K74), H111 (= H107)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G18), F24 (= F20), D48 (= D44), Y53 (= Y49), H111 (= H107), S140 (≠ A135), N141 (= N136), Q162 (= Q157), W188 (= W183), S189 (≠ G184), P190 (= P185), L191 (≠ F186), Q193 (≠ E188), L197 (≠ F194), I229 (= I226), K231 (= K228), S232 (= S229), K234 (≠ H231), R237 (= R234), E240 (= E237), N241 (= N238)
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
46% identity, 92% coverage: 2:260/283 of query aligns to 5:262/276 of Q9GV41
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
46% identity, 92% coverage: 2:260/283 of query aligns to 10:267/281 of 1vbjA
- active site: D52 (= D44), Y57 (= Y49), K82 (= K74), H115 (= H107)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G26 (= G18), M27 (≠ V19), W28 (≠ F20), D52 (= D44), Y57 (= Y49), H115 (= H107), N145 (= N136), Q166 (= Q157), W192 (= W183), S193 (≠ G184), P194 (= P185), L195 (≠ F186), Q197 (≠ E188), G198 (= G189), V201 (≠ F194), A218 (= A211), I233 (= I226), K235 (= K228), S236 (= S229), G237 (≠ V230), R241 (= R234), E244 (= E237), N245 (= N238)
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
44% identity, 94% coverage: 3:269/283 of query aligns to 4:270/275 of A0QV10
- K262 (≠ S261) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3b3dA B.Subtilis ytbe (see paper)
48% identity, 90% coverage: 3:258/283 of query aligns to 8:266/280 of 3b3dA
2wzmA Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form (see paper)
39% identity, 92% coverage: 1:261/283 of query aligns to 2:262/274 of 2wzmA
- active site: D44 (= D44), Y49 (= Y49), K74 (= K74), H107 (= H107)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: Y186 (≠ W183), G187 (= G184), P188 (= P185), L189 (≠ F186), G190 (≠ A187), V191 (≠ E188), G192 (= G189), L195 (≠ F194), A212 (= A211), I227 (= I226), R229 (≠ K228), S230 (= S229), R235 (= R234), N239 (= N238)
Sites not aligning to the query:
A0QV09 Aldo-keto reductase MSMEG_2407/MSMEI_2346; AKR; AKR5H1; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
39% identity, 92% coverage: 1:261/283 of query aligns to 11:271/283 of A0QV09
- G196 (= G184) binding
- L198 (≠ F186) binding
- V200 (≠ E188) binding
- I236 (= I226) binding
- R238 (≠ K228) binding
- S239 (= S229) binding
- A240 (≠ V230) binding
- R244 (= R234) binding
- S247 (≠ E237) binding
- N248 (= N238) binding
Sites not aligning to the query:
P06632 2,5-diketo-D-gluconic acid reductase A; 2,5-DKG reductase A; 2,5-DKGR A; 25DKGR-A; AKR5C; EC 1.1.1.346 from Corynebacterium sp. (strain ATCC 31090) (see 3 papers)
41% identity, 92% coverage: 1:260/283 of query aligns to 3:264/278 of P06632
- Y50 (= Y49) active site, Proton donor
- H108 (= H107) binding
- 188:242 (vs. 184:238, 40% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1a80A Native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. Complexed with NADPH (see paper)
41% identity, 92% coverage: 1:260/283 of query aligns to 2:263/277 of 1a80A
- active site: D44 (= D44), Y49 (= Y49), K74 (= K74), H107 (= H107)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), F21 (= F20), D44 (= D44), Y49 (= Y49), H107 (= H107), S138 (≠ A135), Q160 (= Q157), W186 (= W183), G187 (= G184), P188 (= P185), L189 (≠ F186), Q191 (≠ E188), A214 (= A211), F229 (≠ I226), K231 (= K228), S232 (= S229), V233 (= V230), R234 (≠ H231), R237 (= R234), E240 (= E237), N241 (= N238)
1m9hA Corynebacterium 2,5-dkgr a and phe 22 replaced with tyr (f22y), lys 232 replaced with gly (k232g), arg 238 replaced with his (r238h)and ala 272 replaced with gly (a272g)in presence of nadh cofactor (see paper)
40% identity, 92% coverage: 1:260/283 of query aligns to 2:263/277 of 1m9hA
- active site: D44 (= D44), Y49 (= Y49), K74 (= K74), H107 (= H107)
- binding nicotinamide-adenine-dinucleotide: G19 (= G18), Y21 (≠ F20), Y49 (= Y49), H107 (= H107), Q160 (= Q157), W186 (= W183), G187 (= G184), P188 (= P185), L189 (≠ F186), Q191 (≠ E188), A214 (= A211), F229 (≠ I226), P230 (= P227), G231 (≠ K228), H237 (≠ R234), N241 (= N238)
3wbwA Crystal structure of gox0644 in complex with NADPH
37% identity, 90% coverage: 4:258/283 of query aligns to 6:256/271 of 3wbwA
- active site: D45 (= D44), Y50 (= Y49), K71 (= K74), H104 (= H107)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G18), H104 (= H107), N136 (= N136), W183 (= W183), R184 (≠ G184), P185 (= P185), L186 (≠ F186), L192 (≠ F194), A209 (= A211), K226 (= K228), S227 (= S229), V228 (= V230), R232 (= R234), E235 (= E237), N236 (= N238)
P16116 Aldo-keto reductase family 1 member B1; 20-alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; Aldehyde reductase; Aldose reductase; AR; EC 1.1.1.21; EC 1.1.1.300; EC 1.1.1.372; EC 1.1.1.54 from Bos taurus (Bovine) (see paper)
40% identity, 89% coverage: 4:254/283 of query aligns to 4:288/315 of P16116
Sites not aligning to the query:
- 1 modified: N-acetylalanine
2ipwA Crystal structure of c298a w219y aldose reductase complexed with dichlorophenylacetic acid (see paper)
38% identity, 98% coverage: 3:279/283 of query aligns to 2:298/309 of 2ipwA
- active site: D42 (= D44), Y47 (= Y49), K76 (= K74), H109 (= H107)
- binding (2,6-dichlorophenyl)acetic acid: W19 (≠ F20), Y47 (= Y49), H109 (= H107)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G17 (= G18), T18 (≠ V19), W19 (≠ F20), K20 (≠ Q21), D42 (= D44), Y47 (= Y49), H109 (= H107), Q179 (= Q157), Y205 (≠ W183), S206 (≠ G184), P207 (= P185), L208 (vs. gap), S210 (vs. gap), P211 (vs. gap), D212 (vs. gap), A239 (= A211), I254 (= I226), P255 (= P227), K256 (= K228), S257 (= S229), V258 (= V230), T259 (≠ H231), R262 (= R234), E265 (= E237), N266 (= N238)
4qxiA Crystal structure of human ar complexed with NADP+ and ak198 (see paper)
37% identity, 98% coverage: 3:279/283 of query aligns to 4:305/314 of 4qxiA
- active site: D44 (= D44), Y49 (= Y49), K78 (= K74), H111 (= H107)
- binding {2-[(4-amino-2-fluorobenzyl)carbamoyl]-5-chlorophenoxy}acetic acid: W21 (≠ F20), V48 (≠ A48), Y49 (= Y49), H111 (= H107), W112 (≠ Q108), F123 (vs. gap), A300 (≠ K274), L301 (≠ W275)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), T20 (≠ V19), W21 (≠ F20), K22 (≠ Q21), D44 (= D44), Y49 (= Y49), H111 (= H107), N161 (= N136), Q184 (= Q157), Y210 (≠ W183), S211 (≠ G184), P212 (= P185), L213 (≠ F186), S215 (≠ E188), P216 (≠ G189), D217 (≠ K190), A246 (= A211), I261 (= I226), P262 (= P227), K263 (= K228), S264 (= S229), V265 (= V230), T266 (≠ H231), R269 (= R234), E272 (= E237), N273 (= N238), C299 (≠ V273)
6tucA Human aldose reductase in complex with alr25
37% identity, 98% coverage: 3:279/283 of query aligns to 4:305/313 of 6tucA
- active site: D44 (= D44), Y49 (= Y49), K78 (= K74), H111 (= H107)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), T20 (≠ V19), W21 (≠ F20), K22 (≠ Q21), D44 (= D44), Y49 (= Y49), H111 (= H107), N161 (= N136), Q184 (= Q157), Y210 (≠ W183), S211 (≠ G184), P212 (= P185), L213 (≠ F186), S215 (≠ E188), P216 (≠ G189), D217 (≠ K190), A246 (= A211), I261 (= I226), P262 (= P227), K263 (= K228), S264 (= S229), V265 (= V230), T266 (≠ H231), R269 (= R234), E272 (= E237), N273 (= N238), C299 (≠ V273)
- binding 2-(2-((3-boronobenzyl)carbamoyl)-5-fluorophenoxy)acetic acid: W21 (≠ F20), V48 (≠ A48), Y49 (= Y49), H111 (= H107)
8bjlA Human aldose reductase in complex with a ligand with a fluoro-indol- acetic-acid structure (schl44172)
37% identity, 98% coverage: 3:279/283 of query aligns to 4:305/316 of 8bjlA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), T20 (≠ V19), W21 (≠ F20), K22 (≠ Q21), D44 (= D44), Y49 (= Y49), H111 (= H107), N161 (= N136), Q184 (= Q157), Y210 (≠ W183), S211 (≠ G184), P212 (= P185), L213 (≠ F186), S215 (≠ E188), P216 (≠ G189), D217 (≠ K190), A246 (= A211), I261 (= I226), P262 (= P227), K263 (= K228), S264 (= S229), V265 (= V230), T266 (≠ H231), R269 (= R234), E272 (= E237), N273 (= N238), C299 (≠ V273)
- binding 2-(6-fluoranylindol-1-yl)ethanoic acid: W21 (≠ F20), Y49 (= Y49), H111 (= H107), W220 (vs. gap), W220 (vs. gap), C299 (≠ V273), L301 (≠ W275), L301 (≠ W275), L302 (= L276)
Query Sequence
>Echvi_4178 FitnessBrowser__Cola:Echvi_4178
MKKIKLNNGLEMPLLGFGVFQIPDLKECERAVMDAINIGYRLIDTASAYMNEAAVGNAII
KSGVARKELFITSKLWVQDMGYESTKAAFRRTLERLQLDYLDLYLIHQPYGDVFGSWKAM
QELYQAGKIKAIGVANFQPDRVVDLTINSGFAPAINQIETHPFHQQQESHDFLIDHNVQM
QSWGPFAEGKNGIFQNEVLSEIGRKYNKSIAQVILRWLIQRNVIAIPKSVHKERIEENFR
IFDFEISKEDMHSIAALDTGSTLFFDHRNPEMVKWLSETKLDI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory