Comparing Echvi_4222 FitnessBrowser__Cola:Echvi_4222 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jkvA Structure of human phosphogluconate dehydrogenase in complex with NADPH at 2.53a
59% identity, 99% coverage: 5:484/484 of query aligns to 3:482/482 of 2jkvA
P52209 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Homo sapiens (Human)
59% identity, 99% coverage: 5:484/484 of query aligns to 4:483/483 of P52209
1pgqA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
60% identity, 97% coverage: 5:474/484 of query aligns to 3:472/473 of 1pgqA
1pgpA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
60% identity, 97% coverage: 5:474/484 of query aligns to 3:472/473 of 1pgpA
1pgoA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
60% identity, 97% coverage: 5:474/484 of query aligns to 3:472/473 of 1pgoA
1pgnA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
60% identity, 97% coverage: 5:474/484 of query aligns to 3:472/473 of 1pgnA
5uq9E Crystal structure of 6-phosphogluconate dehydrogenase with ((4r,5r)-5- (hydroxycarbamoyl)-2,2-dimethyl-1,3-dioxolan-4-yl)methyl dihydrogen phosphate (see paper)
60% identity, 96% coverage: 5:470/484 of query aligns to 3:468/468 of 5uq9E
2w90B Geobacillus stearothermophilus 6-phosphogluconate dehydrogenase with bound 6- phosphogluconate (see paper)
58% identity, 96% coverage: 7:470/484 of query aligns to 8:469/471 of 2w90B
P78812 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
56% identity, 100% coverage: 3:484/484 of query aligns to 5:492/492 of P78812
2p4qA Crystal structure analysis of gnd1 in saccharomyces cerevisiae (see paper)
58% identity, 96% coverage: 5:471/484 of query aligns to 3:476/476 of 2p4qA
7cb2A The 6-phosphogluconate dehydrogenase (NADP-bound) from staphylococcus aureus
54% identity, 96% coverage: 7:470/484 of query aligns to 5:465/466 of 7cb2A
7cb5B The 6-phosphogluconate dehydrogenase from staphylococcus aureus (6- phosphogluconate bound) (see paper)
54% identity, 96% coverage: 7:470/484 of query aligns to 5:465/467 of 7cb5B
P00350 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Escherichia coli (strain K12) (see paper)
52% identity, 97% coverage: 1:470/484 of query aligns to 1:466/468 of P00350
P96789 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Lactococcus lactis subsp. cremoris (strain MG1363) (see paper)
52% identity, 97% coverage: 5:473/484 of query aligns to 4:471/472 of P96789
2iyoA Structural characterization of a bacterial 6pdh reveals aspects of specificity, mechanism and mode of inhibition (see paper)
52% identity, 96% coverage: 5:470/484 of query aligns to 4:468/470 of 2iyoA
2iypA Product rup (see paper)
52% identity, 96% coverage: 5:470/484 of query aligns to 4:468/469 of 2iypA
2iypB Product rup (see paper)
52% identity, 96% coverage: 5:470/484 of query aligns to 5:469/470 of 2iypB
2iz1B 6pdh complexed with pex inhibitor synchrotron data (see paper)
52% identity, 96% coverage: 5:470/484 of query aligns to 6:470/471 of 2iz1B
2zydA Dimeric 6-phosphogluconate dehydrogenase complexed with glucose (see paper)
52% identity, 96% coverage: 7:470/484 of query aligns to 4:464/464 of 2zydA
3fwnB Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
52% identity, 96% coverage: 7:470/484 of query aligns to 5:465/467 of 3fwnB
>Echvi_4222 FitnessBrowser__Cola:Echvi_4222
MSKLADIGLIGLAVMGENLVLNMESKGFSVAVYNRSTDKVDKFIQGRGAGKNFIGTHSVK
ELVDSLQKPRKVMMLVKAGDPVDSFIEQIIPHLEEGDIIIDGGNSNFTDTIRRTEYVESK
GFQYVGTGVSGGEIGALRGPSMMPGGSKSAWPHVKEIFQSVSAKVDGGVPCCDWVGADGA
GHYVKMIHNGIEYGDMQIITEAYQFMKDVLGMDYDEMHKTFKKWNSEELDSYLIEITADI
LAYKDEDGEPMVEKILDTAGQKGTGKWTGIEAMHLGVPLTLIAESVFSRFLSAQLELRDQ
ASQVFDAPAISFDGNKEAMLEDLKMAVYGAKIISYAQGYNLLMEASKEHNWELNYGDIAL
MWRGGCIIRSAFLGDIKKAFDKNPGLPHLLLDDFFKEKVQNAQAGWRKVCAAAVTNGIPV
PALSAALAYFDGFRTKRLPANLLQAQRDYFGAHTYERTDKPRGEFFHTNWTGEGADTVST
AYNS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory