Comparing Echvi_4311 FitnessBrowser__Cola:Echvi_4311 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
30% identity, 89% coverage: 41:385/386 of query aligns to 57:400/401 of 7nutA
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
31% identity, 83% coverage: 41:361/386 of query aligns to 53:369/393 of 2vhlB
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
31% identity, 83% coverage: 41:361/386 of query aligns to 54:370/396 of O34450
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
29% identity, 83% coverage: 42:363/386 of query aligns to 51:361/378 of O32445
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
29% identity, 83% coverage: 42:363/386 of query aligns to 52:362/379 of 3iv8A
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
29% identity, 91% coverage: 32:383/386 of query aligns to 42:381/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 91% coverage: 32:383/386 of query aligns to 42:381/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
28% identity, 91% coverage: 32:383/386 of query aligns to 42:381/382 of 2p53A
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
28% identity, 91% coverage: 32:383/386 of query aligns to 42:380/381 of 1yrrA
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
27% identity, 93% coverage: 27:384/386 of query aligns to 27:363/363 of 1o12A
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
27% identity, 91% coverage: 32:383/386 of query aligns to 42:355/356 of 2p50B
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
27% identity, 89% coverage: 20:362/386 of query aligns to 28:367/385 of 6jkuA
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
30% identity, 62% coverage: 42:281/386 of query aligns to 51:283/381 of 6fv4A
Sites not aligning to the query:
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
30% identity, 62% coverage: 42:281/386 of query aligns to 51:283/385 of 6fv4B
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
30% identity, 60% coverage: 42:274/386 of query aligns to 49:274/350 of 6fv3D
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
30% identity, 62% coverage: 32:270/386 of query aligns to 41:258/334 of 1yrrB
>Echvi_4311 FitnessBrowser__Cola:Echvi_4311
MGKIEHIEGIHYQTQRPIRLTFDGEWITGMEEQEHISSSLMIAPGLVDLQVNGFQGVDFN
EPGLTVDEVVSCTRRLWENGVTTFFPTLITASEAALSDAIKKIVQACQDPVIARTIAGIH
LEGPFISKDAGPRGAHPLKYVQAPNWGLVSRLQKVAKGKIKLVTLSPEHDQTNEVIKKCV
AEQIHVAIGHTAAKTDQLGKAVEVGADLSTHLGNAAHLSLPRHPNYIWDQLALDGLWTSM
ISDGFHLPDAVMKVFMRVKPDKTFLVSDSTKFAGQPAGSYQSPIGGTVRLSPGGRLCMQD
NPNLLAGSAASLKSCLEYLARAKLASLPQAIDMASIRPLSYLAKGKKIKAFQKGSRADVV
LFEYKDHKMVIHRAIKSGRQVYSSEI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory