Comparing Echvi_4343 FitnessBrowser__Cola:Echvi_4343 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9S4K9 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Clostridium perfringens (strain 13 / Type A) (see paper)
29% identity, 89% coverage: 6:280/309 of query aligns to 1:271/288 of Q9S4K9
3lbcD D-sialic acid aldolase complexed with l-arabinose
29% identity, 94% coverage: 5:296/309 of query aligns to 4:292/296 of 3lbcD
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
29% identity, 94% coverage: 5:296/309 of query aligns to 1:289/292 of 1fdzA
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
29% identity, 94% coverage: 5:296/309 of query aligns to 1:289/292 of 1fdyA
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
29% identity, 94% coverage: 5:296/309 of query aligns to 9:297/302 of 2wpbA
4wozB Crystal structures of cdnal from clostridium difficile in complex with mannosamine
27% identity, 89% coverage: 6:280/309 of query aligns to 3:273/290 of 4wozB
4woqC Crystal structures of cdnal from clostridium difficile in complex with ketobutyric
27% identity, 89% coverage: 6:280/309 of query aligns to 3:273/290 of 4woqC
4bwlA Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
29% identity, 94% coverage: 5:296/309 of query aligns to 6:294/299 of 4bwlA
4bwlC Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
29% identity, 94% coverage: 5:296/309 of query aligns to 4:292/296 of 4bwlC
Q2G160 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
28% identity, 95% coverage: 4:296/309 of query aligns to 3:287/293 of Q2G160
6rd1A Ruminococcus gnavus sialic acid aldolase catalytic lysine mutant in complex with sialic acid (see paper)
28% identity, 94% coverage: 2:291/309 of query aligns to 2:291/304 of 6rd1A
6rb7A Ruminococcus gnavus sialic acid aldolase catalytic lysine mutant (see paper)
28% identity, 94% coverage: 2:291/309 of query aligns to 3:292/305 of 6rb7A
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
27% identity, 94% coverage: 9:299/309 of query aligns to 8:295/295 of 5ktlA
5ud6C Crystal structure of dhdps from cyanidioschyzon merolae with lysine bound
27% identity, 94% coverage: 9:300/309 of query aligns to 7:299/299 of 5ud6C
1f7bA Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid (see paper)
27% identity, 89% coverage: 4:278/309 of query aligns to 2:272/293 of 1f7bA
1f74A Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid (see paper)
27% identity, 89% coverage: 4:278/309 of query aligns to 2:272/293 of 1f74A
4imfA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-acetylneuraminic acid (see paper)
28% identity, 90% coverage: 4:280/309 of query aligns to 1:273/292 of 4imfA
4imgA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-glycolylneuraminic acid (see paper)
28% identity, 90% coverage: 4:280/309 of query aligns to 2:274/293 of 4imgA
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
28% identity, 94% coverage: 6:296/309 of query aligns to 6:293/297 of 8u8wA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
30% identity, 88% coverage: 5:277/309 of query aligns to 8:274/297 of 5j5dA
>Echvi_4343 FitnessBrowser__Cola:Echvi_4343
MKFKKIHGLIAATFTPFCEDGSLDERKIPVLAQSLRANGMAGAFIAGTTGEGAAMTYDEK
IRLLEAWAPFSAAEFKVMAMLGGTSQKEAIALADRANALGIYGIAMTAPYYMRPNSVKQL
VDYYESIAAAAPDQAFYFYHIPLLSKVELPMLDFLEEVGERIPNFAGIKYTHNDLMEFNR
CLRFQGGKYDILWGWDETMLAGLSMGAKGAVGSTYNYAGPLYQNLMEAFQQQDMEAARHW
QEKSIDLISLFGHYGGAACGKAIMKLCGLDCGQFRYPVKQLEKGDYEELKECLDQLGFFQ
YSSNEKQEQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory