SitesBLAST
Comparing Echvi_4411 FitnessBrowser__Cola:Echvi_4411 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
33% identity, 84% coverage: 44:287/292 of query aligns to 2:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G53), M16 (≠ I58), D35 (≠ G77), I36 (≠ M78), I62 (= I104), N88 (≠ C130), G90 (= G132), I138 (≠ V183), S140 (= S185), Y152 (= Y198), K156 (= K202), I185 (≠ V231)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
33% identity, 84% coverage: 44:287/292 of query aligns to 3:245/248 of Q9KJF1
- S15 (≠ G56) binding
- D36 (≠ G77) binding
- D62 (= D103) binding
- I63 (= I104) binding
- N89 (≠ C130) binding
- Y153 (= Y198) binding
- K157 (= K202) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
35% identity, 83% coverage: 44:284/292 of query aligns to 4:243/247 of P73574
- A14 (≠ G54) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ A193) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K202) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ I230) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ Q240) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
34% identity, 83% coverage: 44:284/292 of query aligns to 3:240/244 of 6t77A
- active site: G16 (≠ A57), S138 (= S185), Y151 (= Y198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G53), S14 (= S55), R15 (≠ G56), T37 (≠ M78), L58 (≠ K99), N59 (≠ R100), V60 (≠ Q101), A87 (= A131), G88 (= G132), I89 (≠ G133)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
33% identity, 83% coverage: 44:284/292 of query aligns to 2:239/243 of 1q7bA
- active site: G15 (≠ A57), E101 (≠ T149), S137 (= S185), Q147 (≠ F195), Y150 (= Y198), K154 (= K202)
- binding calcium ion: E232 (≠ Q277), T233 (≠ N278)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G53), S13 (= S55), R14 (≠ G56), T36 (≠ M78), N58 (≠ R100), V59 (≠ Q101), N85 (≠ C130), A86 (= A131), G87 (= G132), I88 (≠ G133), S137 (= S185), Y150 (= Y198), K154 (= K202), P180 (= P228), G181 (= G229), I183 (≠ V231)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 83% coverage: 44:284/292 of query aligns to 3:240/244 of P0AEK2
- GASR 12:15 (≠ GGSG 53:56) binding
- T37 (≠ M78) binding
- NV 59:60 (≠ RQ 100:101) binding
- N86 (≠ C130) binding
- Y151 (= Y198) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (= YAAAK 198:202) binding
- A154 (= A201) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K202) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V231) binding
- E233 (≠ Q277) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
32% identity, 84% coverage: 44:287/292 of query aligns to 5:253/254 of 4fn4A
- active site: G18 (≠ A57), S144 (= S185), Y157 (= Y198), K161 (= K202), S202 (≠ A239)
- binding nicotinamide-adenine-dinucleotide: G14 (= G53), S17 (≠ G56), G18 (≠ A57), I19 (= I58), E38 (≠ G77), L39 (≠ M78), R43 (≠ K82), A63 (≠ L102), D64 (= D103), V65 (≠ I104), N91 (≠ C130), G93 (= G132), I94 (≠ A135), T142 (≠ V183), S144 (= S185), Y157 (= Y198), K161 (= K202), P187 (= P228), V190 (= V231), T192 (≠ R233), N193 (vs. gap), I194 (vs. gap)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
34% identity, 83% coverage: 44:284/292 of query aligns to 3:244/247 of 4jroC
- active site: G16 (≠ A57), S142 (= S185), Q152 (≠ F195), Y155 (= Y198), K159 (= K202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G53), S14 (= S55), R15 (≠ G56), G16 (≠ A57), I17 (= I58), N35 (vs. gap), Y36 (≠ C76), N37 (≠ G77), G38 (≠ M78), S39 (= S79), N63 (≠ D103), V64 (≠ I104), N90 (≠ C130), A91 (= A131), I93 (≠ G133), I113 (≠ V156), S142 (= S185), Y155 (= Y198), K159 (= K202), P185 (= P228), I188 (≠ V231), T190 (≠ R233)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
33% identity, 83% coverage: 44:284/292 of query aligns to 2:239/243 of 1q7cA
- active site: G15 (≠ A57), S137 (= S185), Q147 (≠ F195), F150 (≠ Y198), K154 (= K202)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G53), S13 (= S55), R14 (≠ G56), A35 (≠ G77), T36 (≠ M78), L57 (≠ K99), N58 (≠ R100), V59 (≠ Q101), G87 (= G132), I88 (≠ G133)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
35% identity, 83% coverage: 44:284/292 of query aligns to 4:243/247 of 3rwbA
- active site: G17 (≠ A57), S140 (= S185), Y153 (= Y198), K157 (= K202)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S185), N141 (≠ V186), T142 (≠ I187), M150 (≠ F195), Y153 (= Y198), L185 (≠ I230), H196 (≠ A239)
- binding nicotinamide-adenine-dinucleotide: G13 (= G53), Q16 (≠ G56), G17 (≠ A57), I18 (= I58), D37 (≠ G77), I38 (≠ M78), D60 (= D103), I61 (= I104), N87 (≠ C130), A88 (= A131), S89 (≠ A138), I138 (≠ V183), S140 (= S185), Y153 (= Y198), K157 (= K202), P183 (= P228), L185 (≠ I230), I186 (≠ V231), S188 (≠ R233), G190 (≠ T235), V191 (≠ I236)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
35% identity, 83% coverage: 44:284/292 of query aligns to 4:243/247 of 3ndrA
- active site: G17 (≠ A57), S140 (= S185), Y153 (= Y198), K157 (= K202)
- binding nicotinamide-adenine-dinucleotide: G13 (= G53), Q16 (≠ G56), G17 (≠ A57), I18 (= I58), D37 (≠ G77), I38 (≠ M78), D60 (= D103), I61 (= I104), N87 (≠ C130), A88 (= A131), S89 (≠ A138), V110 (= V156), I138 (≠ V183), S140 (= S185), Y153 (= Y198), K157 (= K202), P183 (= P228), L185 (≠ I230), I186 (≠ V231), S188 (≠ R233), G190 (≠ T235), V191 (≠ I236)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
32% identity, 83% coverage: 44:284/292 of query aligns to 6:248/251 of 4cqlI
- active site: G19 (≠ A57), S146 (= S185), Y159 (= Y198), K163 (= K202)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ G56), G19 (≠ A57), I20 (= I58), D39 (≠ G77), L40 (≠ M78), A64 (≠ L102), D65 (= D103), V66 (≠ I104), C93 (= C130), A94 (= A131), G95 (= G132), I96 (≠ G133), V116 (= V156), I144 (≠ V183), S146 (= S185), Y159 (= Y198), K163 (= K202), P189 (= P228), G190 (= G229), I192 (≠ V231), T194 (≠ R233), M196 (≠ T235)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
35% identity, 83% coverage: 44:284/292 of query aligns to 6:239/243 of 4i08A
- active site: G19 (≠ A57), N113 (= N157), S141 (= S185), Q151 (≠ F195), Y154 (= Y198), K158 (= K202)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G53), S17 (= S55), R18 (≠ G56), I20 (= I58), T40 (≠ M78), N62 (≠ D103), V63 (≠ I104), N89 (≠ C130), A90 (= A131), G140 (≠ T184), S141 (= S185), Y154 (= Y198), K158 (= K202), P184 (= P228), G185 (= G229), T189 (≠ R233)
6zyzA Structure of the borneol dehydrogenases of salvia rosmarinus with NAD+ (see paper)
32% identity, 84% coverage: 44:287/292 of query aligns to 3:248/259 of 6zyzA
- binding nicotinamide-adenine-dinucleotide: G12 (= G53), S15 (≠ G56), G16 (≠ A57), I17 (= I58), D36 (≠ G77), I37 (≠ M78), Q38 (≠ S79), C58 (≠ L102), D59 (= D103), V60 (≠ I104), N86 (≠ C130), A87 (= A131), V90 (≠ R136), I110 (≠ V156), T137 (≠ V183), Y152 (= Y198), K156 (= K202), V185 (= V231)
- binding (2S)-1-[3-{[(2R)-2-hydroxypropyl]oxy}-2,2-bis({[(2R)-2-hydroxypropyl]oxy}methyl)propoxy]propan-2-ol: P93 (≠ S139), N94 (≠ R140), S95 (≠ P141), D98 (≠ E144)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
31% identity, 83% coverage: 44:284/292 of query aligns to 3:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G53), Q15 (≠ G56), G16 (≠ A57), I17 (= I58), D36 (≠ G77), V63 (≠ I104), N89 (≠ C130), A91 (≠ G132), S94 (≠ A135), I142 (≠ V183), S143 (≠ T184), S144 (= S185), Y157 (= Y198), K161 (= K202), P187 (= P228), H188 (vs. gap), I190 (= I230), I194 (vs. gap)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
32% identity, 83% coverage: 43:284/292 of query aligns to 2:244/248 of 4urfB
- active site: G16 (≠ A57), S142 (= S185), I152 (≠ F195), Y155 (= Y198), K159 (= K202)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M250), R211 (≠ N251), R212 (≠ D252)
- binding bicarbonate ion: I92 (≠ G133), G94 (≠ A135), R109 (≠ T152), R179 (≠ T222), S228 (≠ R268)
- binding nicotinamide-adenine-dinucleotide: G12 (= G53), G14 (≠ S55), N15 (≠ G56), G16 (≠ A57), I17 (= I58), D36 (≠ G77), I37 (≠ M78), D62 (= D103), T63 (≠ I104), N89 (≠ C130), A90 (= A131), G91 (= G132), I140 (≠ V183), Y155 (= Y198), K159 (= K202), P185 (= P228), A186 (≠ G229), I188 (≠ V231), T190 (≠ R233)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
32% identity, 83% coverage: 43:284/292 of query aligns to 2:244/248 of 4urfA
- active site: G16 (≠ A57), S142 (= S185), I152 (≠ F195), Y155 (= Y198), K159 (= K202)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ G133), S93 (= S134), G94 (≠ A135), E95 (≠ R136), T97 (≠ R140), E101 (= E144), T103 (≠ E146), Q106 (≠ T149), R109 (≠ T152), S175 (≠ K218), G177 (= G220)
- binding magnesium ion: S237 (≠ Q277), Y238 (≠ N278)
- binding nicotinamide-adenine-dinucleotide: G12 (= G53), G14 (≠ S55), N15 (≠ G56), G16 (≠ A57), I17 (= I58), D36 (≠ G77), I37 (≠ M78), W41 (≠ K82), D62 (= D103), T63 (≠ I104), N89 (≠ C130), A90 (= A131), G91 (= G132), I140 (≠ V183), Y155 (= Y198), K159 (= K202), P185 (= P228), I188 (≠ V231), T190 (≠ R233)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
32% identity, 83% coverage: 43:284/292 of query aligns to 2:244/248 of 4ureB
- active site: G16 (≠ A57), S142 (= S185), I152 (≠ F195), Y155 (= Y198), K159 (= K202)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ G56), G16 (≠ A57), I17 (= I58), N89 (≠ C130), G91 (= G132), Y155 (= Y198), P185 (= P228), A186 (≠ G229)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 83% coverage: 44:284/292 of query aligns to 3:240/244 of P0A2C9
- M125 (= M172) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ T267) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (≠ R268) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
34% identity, 83% coverage: 44:284/292 of query aligns to 6:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G53), S17 (= S55), R18 (≠ G56), I20 (= I58), T40 (≠ M78), N62 (≠ D103), V63 (≠ I104), N89 (≠ C130), A90 (= A131), I92 (≠ G133), V139 (= V183), S141 (= S185), Y154 (= Y198), K158 (= K202), P184 (= P228), G185 (= G229), I187 (≠ V231), T189 (vs. gap), M191 (vs. gap)
Query Sequence
>Echvi_4411 FitnessBrowser__Cola:Echvi_4411
MKSLIKRLVPKGMRNKLKGMAPGNSGGQAVAVPYTIQVSTPGLLKGKVAVVTGGSGAIGR
AICCRLAADGALVVVCGMSHDKMQGVVDEIGANGGKAVKRQLDISSEEKIIEFYQWLKES
YGQLDILVNCAGGSARQASRPIYELETETIDTTLHVNLRGAILVTREASKIMVAAKRGTI
VSVTSVIGEHGKAKFSEYAAAKAGIIAFTKSIAMELGKLGITANCVSPGIVQRGTITPAQ
MAKLKKTNYMNDYGRPEDISEMVAYLTREEGKFITGQNFKVDGGRSLGLKGD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory