SitesBLAST
Comparing Echvi_4494 FitnessBrowser__Cola:Echvi_4494 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
44% identity, 97% coverage: 1:388/402 of query aligns to 1:398/403 of 3ozwA
- binding flavin-adenine dinucleotide: A46 (≠ T46), Q50 (≠ K50), R206 (= R206), Q207 (≠ N207), Y208 (= Y208), S209 (= S209), S222 (= S222), V223 (= V223), K224 (= K224), E226 (= E226), P232 (≠ Y230), G234 (= G232), Y235 (≠ L233), V236 (= V234), S237 (= S235), V276 (= V273), T279 (= T276), V395 (≠ F385), F396 (= F386)
- binding protoporphyrin ix containing fe: V42 (≠ L42), F43 (= F43), I81 (= I81), H85 (= H85), L88 (= L88), V90 (≠ I90), Q94 (≠ M94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), A130 (= A130), L133 (≠ F133)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: Q53 (= Q53), A56 (≠ V56), L102 (= L102), P398 (= P388)
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
44% identity, 97% coverage: 1:388/402 of query aligns to 1:398/403 of 3ozvA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: I24 (= I24), F28 (= F28), L57 (= L57), L102 (= L102), I106 (= I106)
- binding flavin-adenine dinucleotide: N44 (= N44), A46 (≠ T46), Q48 (= Q48), R206 (= R206), Q207 (≠ N207), Y208 (= Y208), S209 (= S209), S222 (= S222), V223 (= V223), K224 (= K224), E226 (= E226), P232 (≠ Y230), G234 (= G232), Y235 (≠ L233), V236 (= V234), S237 (= S235), V276 (= V273), T279 (= T276), F396 (= F386)
- binding protoporphyrin ix containing fe: F43 (= F43), I81 (= I81), K84 (= K84), H85 (= H85), L88 (= L88), V90 (≠ I90), Q94 (≠ M94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), A130 (= A130), L133 (≠ F133)
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
44% identity, 97% coverage: 1:388/402 of query aligns to 1:398/403 of 3ozuA
- binding flavin-adenine dinucleotide: A46 (≠ T46), H47 (≠ N47), R206 (= R206), Q207 (≠ N207), Y208 (= Y208), S209 (= S209), S222 (= S222), V223 (= V223), K224 (= K224), E226 (= E226), P232 (≠ Y230), G234 (= G232), Y235 (≠ L233), V236 (= V234), S237 (= S235), E394 (= E384), V395 (≠ F385), G397 (= G387), P398 (= P388)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (= L88), V90 (≠ I90), Q94 (≠ M94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), L129 (= L129), A130 (= A130), L133 (≠ F133)
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: I25 (≠ T25), F28 (= F28), F43 (= F43), A56 (≠ V56), L57 (= L57), L102 (= L102), W122 (= W122), A125 (= A125), Y126 (= Y126)
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
44% identity, 97% coverage: 1:388/402 of query aligns to 1:398/403 of P39662
- A60 (= A60) mutation to Y: Does not affect phospholipid-binding.
- V98 (= V98) mutation to F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
44% identity, 97% coverage: 1:388/402 of query aligns to 1:398/403 of 1cqxA
- binding flavin-adenine dinucleotide: A46 (≠ T46), H47 (≠ N47), Y190 (= Y190), R206 (= R206), Q207 (≠ N207), Y208 (= Y208), S209 (= S209), S222 (= S222), E226 (= E226), Q231 (≠ K229), P232 (≠ Y230), G234 (= G232), Y235 (≠ L233), V236 (= V234), S237 (= S235), V395 (≠ F385), G397 (= G387), P398 (= P388)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (= L88), V90 (≠ I90), Q94 (≠ M94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), L129 (= L129), A130 (= A130), L133 (≠ F133)
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
37% identity, 98% coverage: 1:392/402 of query aligns to 1:396/396 of 1gvhA
- binding flavin-adenine dinucleotide: S46 (≠ T46), Q48 (= Q48), N50 (≠ K50), Y188 (= Y190), R204 (= R206), Q205 (≠ N207), Y206 (= Y208), S207 (= S209), A220 (≠ S222), V221 (= V223), E224 (= E226), G227 (= G232), Q228 (≠ L233), V229 (= V234), S230 (= S235), V269 (= V273), T272 (= T276), E388 (= E384), F390 (= F386)
- binding protoporphyrin ix containing fe: F43 (= F43), Q53 (= Q53), A56 (≠ V56), L57 (= L57), A60 (= A60), I61 (= I61), I81 (= I81), K84 (= K84), H85 (= H85), I90 (= I90), Q94 (≠ M94), Y95 (= Y95), L127 (= L129), F131 (= F133), H393 (≠ K389)
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 98% coverage: 1:392/402 of query aligns to 1:396/396 of P24232
- Y29 (= Y29) mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; mutation to F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- Y95 (= Y95) active site, Charge relay system
- E135 (= E137) active site, Charge relay system
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
39% identity, 97% coverage: 1:389/402 of query aligns to 1:393/398 of 4g1bA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: F28 (= F28), Y29 (= Y29), A56 (≠ V56), L57 (= L57), T60 (≠ A60), L102 (= L102), Y126 (= Y126)
- binding flavin-adenine dinucleotide: T46 (= T46), V50 (≠ K50), K84 (= K84), Y189 (= Y190), R207 (= R206), H208 (≠ N207), Y209 (= Y208), S210 (= S209), A223 (≠ S222), K225 (= K224), E227 (= E226), F233 (vs. gap), P234 (vs. gap), G236 (= G232), L237 (= L233), V238 (= V234), S239 (= S235), V282 (= V273), F390 (= F386)
- binding protoporphyrin ix containing fe: I42 (≠ L42), F43 (= F43), N44 (= N44), N47 (= N47), T60 (≠ A60), Q80 (≠ S80), I81 (= I81), K84 (= K84), H85 (= H85), L88 (= L88), I90 (= I90), H94 (≠ M94), Y95 (= Y95), V98 (= V98), F133 (= F133), P392 (= P388), K393 (= K389)
Sites not aligning to the query:
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
33% identity, 97% coverage: 3:390/402 of query aligns to 14:387/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
6o0aA Crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing (see paper)
29% identity, 94% coverage: 9:387/402 of query aligns to 10:383/383 of 6o0aA
- binding flavin-adenine dinucleotide: S48 (≠ T46), R51 (≠ V49), D52 (≠ K50), Y190 (= Y190), R205 (= R206), Q206 (≠ N207), F207 (≠ Y208), T208 (≠ S209), K222 (= K224), D224 (≠ E226), H226 (≠ Y230), G227 (≠ K231), E228 (≠ G232), M229 (≠ L233), T230 (≠ V234), T274 (= T276), E380 (= E384), F382 (= F386), G383 (= G387)
- binding protoporphyrin ix containing fe: M44 (≠ L42), F45 (= F43), S46 (≠ N44), L59 (= L57), S62 (≠ A60), R84 (≠ S80), V85 (≠ I81), H89 (= H85), L92 (= L88), L94 (≠ I90), E98 (≠ M94), Y99 (= Y95), V102 (= V98), Y130 (= Y126), L133 (= L129)
3tm9A Y29a mutant of vitreoscilla stercoraria hemoglobin (see paper)
49% identity, 36% coverage: 1:143/402 of query aligns to 1:143/146 of 3tm9A
- binding protoporphyrin ix containing fe: L42 (= L42), F43 (= F43), Q53 (= Q53), L57 (= L57), T60 (≠ A60), I81 (= I81), K84 (= K84), H85 (= H85), V90 (≠ I90), Y95 (= Y95), V98 (= V98), Y126 (= Y126), F133 (= F133)
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
33% identity, 58% coverage: 155:388/402 of query aligns to 4:237/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (= Y190), R55 (= R206), Q56 (≠ N207), Y57 (= Y208), S58 (= S209), S71 (= S222), V72 (= V223), E75 (= E226), N81 (≠ Y230), G83 (= G232), L84 (= L233), V85 (= V234), S86 (= S235), T127 (= T276), E233 (= E384), F235 (= F386)
4vhbA Thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
48% identity, 36% coverage: 1:143/402 of query aligns to 1:135/138 of 4vhbA
- binding protoporphyrin ix containing fe: L42 (= L42), F43 (= F43), L49 (= L57), T52 (≠ A60), I73 (= I81), K76 (= K84), H77 (= H85), V82 (≠ I90), H86 (≠ M94), Y87 (= Y95), V90 (= V98), F125 (= F133)
- binding thiocyanate ion: F28 (= F28), L49 (= L57)
3vhbA Imidazole adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
49% identity, 35% coverage: 4:143/402 of query aligns to 3:133/135 of 3vhbA
- binding protoporphyrin ix containing fe: F42 (= F43), L47 (= L57), T50 (≠ A60), I71 (= I81), K74 (= K84), H75 (= H85), V80 (≠ I90), H84 (≠ M94), Y85 (= Y95), V88 (= V98), Y116 (= Y126), F123 (= F133)
- binding imidazole: Y28 (= Y29), L47 (= L57)
7dihA Crystal structure of thermoglobin y29f mutant in complex with imidazole
44% identity, 35% coverage: 1:141/402 of query aligns to 1:136/139 of 7dihA
- binding protoporphyrin ix containing fe: L42 (= L42), F43 (= F43), A46 (≠ T46), S47 (≠ N47), Q50 (= Q53), L54 (= L57), I78 (= I81), S81 (≠ K84), H82 (= H85), V87 (≠ I90), H91 (≠ M94), Y92 (= Y95), V95 (= V98), Y121 (= Y126), L124 (= L129)
2wy4A Structure of bacterial globin from campylobacter jejuni at 1.35 a resolution (see paper)
41% identity, 35% coverage: 3:141/402 of query aligns to 1:137/139 of 2wy4A
- binding protoporphyrin ix containing fe: M40 (≠ L42), F41 (= F43), N42 (= N44), Q51 (= Q53), L55 (= L57), A58 (= A60), V79 (≠ I81), T82 (≠ K84), H83 (= H85), L86 (= L88), V88 (≠ I90), H92 (≠ M94), Y93 (= Y95), V96 (= V98), Y129 (≠ F133)
6wk3D Engineered carbene transferase rmanod q52v, putative nitric oxide dioxygenase from rhodothermus marinus (see paper)
35% identity, 35% coverage: 3:141/402 of query aligns to 7:141/146 of 6wk3D
- binding copper (ii) ion: E51 (≠ N47), H55 (≠ G51)
- binding protoporphyrin ix containing fe: L46 (= L42), F47 (= F43), L57 (= L57), R80 (≠ S80), M81 (≠ I81), S84 (≠ K84), H85 (= H85), R87 (≠ S87), A88 (≠ L88), V90 (≠ I90), H94 (≠ M94), Y95 (= Y95), V98 (= V98), Y126 (= Y126)
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
28% identity, 58% coverage: 159:393/402 of query aligns to 438:661/753 of 6laaA
- binding flavin mononucleotide: R487 (= R206), Q488 (≠ N207), Y489 (= Y208), S490 (= S209), Q506 (≠ K224), S511 (≠ K229), R512 (≠ Y230), G514 (= G232), S515 (= S235), I553 (≠ V273), E651 (≠ F383), F653 (= F385)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding fe2/s2 (inorganic) cluster: 700, 702, 703, 705, 707, 708, 710, 740
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
7ylrA Structure of a bacteria protein
25% identity, 57% coverage: 156:386/402 of query aligns to 7:231/326 of 7ylrA
- binding flavin mononucleotide: R56 (= R206), H57 (≠ N207), Y58 (= Y208), S59 (= S209), A79 (≠ S222), V80 (= V223), R81 (≠ K224), G86 (≠ K229), R87 (≠ Y230), G89 (= G232), S90 (= S235), T131 (= T276), E229 (= E384), F231 (= F386)
Sites not aligning to the query:
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
28% identity, 59% coverage: 152:387/402 of query aligns to 6:226/321 of 2piaA
- binding flavin mononucleotide: N44 (≠ S192), R55 (= R206), T56 (≠ N207), Y57 (= Y208), S58 (= S209), A72 (≠ S222), V73 (= V223), G79 (≠ K229), R80 (≠ Y230), G82 (= G232), S83 (≠ L233), I121 (≠ V273), T124 (= T276), E223 (= E384), F225 (= F386)
Sites not aligning to the query:
Query Sequence
>Echvi_4494 FitnessBrowser__Cola:Echvi_4494
MASKSTIEIVKSTAPVLKEYGEQITKVFYKKLFETHPDLRNLFNMTNQVKGTQPKVLANA
IIQYATYIETPEVLLQAVNSIAHKHSSLSITPEMYPIVGETLLWAIKEVLGDAATPDIIG
AWAEAYGELAEIFIAKEDSIYREQKSRMNGYNGQKEFKVVRKIEENKHITSFYLNTTDGS
GLPEFTPGQYISLTLSIPGTDHLHTRNYSLSDYGNKEALRISVKRESGKYKGLVSNYLHD
QVGEGDILSLGMPSGEFYLNSNKGPLVFLAAGVGITPLISMYKSLKGSEREIVFVQCAKN
SESHAFRNEIESQKTDNVTSVVIYEEPLSNDIFDFKGYLTSKVLNDILPSSPSDVYMCGP
KSFMAYALDLLKEHEGKISDVHFEFFGPKEELETQINNLPVN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory