Comparing Echvi_4510 FitnessBrowser__Cola:Echvi_4510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
42% identity, 99% coverage: 5:401/403 of query aligns to 2:392/396 of 6egrA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
42% identity, 99% coverage: 5:401/403 of query aligns to 2:392/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
42% identity, 99% coverage: 5:401/403 of query aligns to 2:392/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
42% identity, 99% coverage: 5:401/403 of query aligns to 2:392/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
42% identity, 99% coverage: 5:401/403 of query aligns to 2:392/396 of 3jw9A
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
42% identity, 99% coverage: 5:401/403 of query aligns to 2:392/396 of 4hf8A
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
42% identity, 99% coverage: 5:401/403 of query aligns to 1:391/395 of 5m3zA
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
41% identity, 99% coverage: 5:401/403 of query aligns to 2:381/386 of 3mkjA
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
40% identity, 99% coverage: 5:402/403 of query aligns to 2:395/399 of 5dx5A
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
41% identity, 97% coverage: 12:401/403 of query aligns to 4:370/373 of 4l0oH
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
42% identity, 97% coverage: 13:401/403 of query aligns to 6:380/384 of 4iyoD
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
42% identity, 97% coverage: 13:401/403 of query aligns to 6:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
42% identity, 97% coverage: 13:401/403 of query aligns to 6:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
42% identity, 97% coverage: 13:401/403 of query aligns to 6:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
42% identity, 97% coverage: 13:401/403 of query aligns to 6:380/381 of 4ixzA
1e5fA Methionine gamma-lyase (mgl) from trichomonas vaginalis
39% identity, 97% coverage: 13:402/403 of query aligns to 7:390/393 of 1e5fA
1e5eA Methionine gamma-lyase (mgl) from trichomonas vaginalis in complex with propargylglycine
39% identity, 97% coverage: 13:402/403 of query aligns to 7:390/394 of 1e5eA
5x5hA Crystal structure of metb from corynebacterium glutamicum (see paper)
39% identity, 99% coverage: 5:402/403 of query aligns to 2:382/385 of 5x5hA
3qhxA Crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes (see paper)
41% identity, 97% coverage: 10:401/403 of query aligns to 2:376/377 of 3qhxA
4ixsB Native structure of xometc at ph 5.2 (see paper)
41% identity, 97% coverage: 13:401/403 of query aligns to 5:371/372 of 4ixsB
>Echvi_4510 FitnessBrowser__Cola:Echvi_4510
MEKPDFKNLGEQTRAIHAGELPDPVTGASSPNLVMSTTYLAEAGTGFSVEGHDEEDPWIY
TRWGNPTVHQLEEKLAVLEEAETAVAFASGMGAITVLFFHLLKAGDHAIVSDVAYAALSE
MTNEMVPSLNIQITKVDTSDLSAVKAAVKNNTRLIYIETPCNPILRLTDIEAVAGIARGA
GARLAVDSTFATPAATKPLQLGADFIVHSLTKYLGGHGDALGGAILGRKADLAPLRKKTA
IRMGAVISPFNAWLILRGLATFPIRMRAHEKNALKVAAFLEKHPKVKRVIYPGLPSHPQH
ELAKKQMKNFSGMLTFQVENGKKRSGIFADKLRIVHYAVSLGHHRSLIFYLDSADLKESS
FKFATGKQDESWEIYAGDGIFRLSVGLEDSKDIIDDLNRALDG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory