Comparing Echvi_4516 FitnessBrowser__Cola:Echvi_4516 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
30% identity, 90% coverage: 12:288/309 of query aligns to 5:280/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
30% identity, 90% coverage: 12:288/309 of query aligns to 5:280/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 90% coverage: 12:288/309 of query aligns to 5:280/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 90% coverage: 12:288/309 of query aligns to 5:280/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 90% coverage: 12:288/309 of query aligns to 5:280/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
30% identity, 90% coverage: 12:288/309 of query aligns to 5:280/298 of 3nevA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
31% identity, 94% coverage: 9:297/309 of query aligns to 1:282/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
31% identity, 94% coverage: 9:297/309 of query aligns to 1:282/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
31% identity, 94% coverage: 9:297/309 of query aligns to 1:282/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
31% identity, 94% coverage: 9:297/309 of query aligns to 1:282/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
31% identity, 94% coverage: 9:297/309 of query aligns to 1:282/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
31% identity, 94% coverage: 9:297/309 of query aligns to 1:282/291 of 3pueB
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
32% identity, 88% coverage: 9:280/309 of query aligns to 1:280/307 of 5c55A
4pfmA Shewanella benthica dhdps with lysine and pyruvate
33% identity, 73% coverage: 10:235/309 of query aligns to 3:226/295 of 4pfmA
Q86XE5 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; Dihydrodipicolinate synthase-like; DHDPS-like protein; Probable 2-keto-4-hydroxyglutarate aldolase; Probable KHG-aldolase; Protein 569272; EC 4.1.3.16 from Homo sapiens (Human) (see paper)
27% identity, 96% coverage: 6:301/309 of query aligns to 31:322/327 of Q86XE5
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
30% identity, 72% coverage: 11:233/309 of query aligns to 6:226/291 of 3di1B
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
30% identity, 72% coverage: 11:233/309 of query aligns to 6:226/295 of Q5HG25
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
26% identity, 93% coverage: 11:297/309 of query aligns to 3:285/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
26% identity, 93% coverage: 11:297/309 of query aligns to 4:286/295 of 1o5kA
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
30% identity, 89% coverage: 11:286/309 of query aligns to 3:272/294 of 4i7wA
>Echvi_4516 FitnessBrowser__Cola:Echvi_4516
MQILDQKISIKGVIPPMVTPMDTNGEVDIQGVEKLVEHLISGGVHGVFILGTTGEFSSLD
IAQKKELIAATCKFVDGRIPVLVGVTDVCLKGSIALSKFAERSGAYAVVAAPPYYMGIDQ
EELCHFYGQLADSIPLPLFLYNMPSHTKVSIDVQTAVALSKHKNIIGLKDSSANGSYFQS
LRYYFNDQPDFVLMVGPEEMLAETVLMGGYGGVCGGANLFPRLYVKLYQAAMAHDIDEII
RLQKLVMTISQNIYRHGGYKSSYLKGLKTALSFSGIIQAQFAPPLFPFAPNEEEELKARF
SKIASMIIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory