SitesBLAST
Comparing Echvi_4558 FitnessBrowser__Cola:Echvi_4558 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
28% identity, 96% coverage: 7:350/358 of query aligns to 2:327/336 of 6iqdA
- active site: C38 (= C43), T40 (≠ S45), H43 (= H48), H61 (= H64), C148 (= C164)
- binding zinc ion: C38 (= C43), H61 (= H64), E62 (= E65), C92 (≠ D100), C95 (≠ S103), C98 (≠ S106), C106 (≠ Y118), C148 (= C164)
1vj0A Crystal structure of alcohol dehydrogenase (tm0436) from thermotoga maritima at 2.00 a resolution
29% identity, 83% coverage: 6:302/358 of query aligns to 5:311/366 of 1vj0A
- active site: C42 (= C43), G43 (≠ A44), S44 (= S45), H47 (= H48), H64 (= H64), E65 (= E65), C99 (≠ H99), C102 (≠ A102), C105 (≠ T105), C114 (≠ S114), K118 (≠ Y118), C165 (= C164), T169 (= T168)
- binding zinc ion: C42 (= C43), H64 (= H64), E65 (= E65), C99 (≠ H99), C102 (≠ A102), C105 (≠ T105), C114 (≠ S114), C165 (= C164)
Sites not aligning to the query:
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
30% identity, 89% coverage: 7:323/358 of query aligns to 2:305/337 of P12311
- C38 (= C43) mutation to S: No activity.
- T40 (≠ S45) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (= H48) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
29% identity, 94% coverage: 7:344/358 of query aligns to 2:321/339 of 1rjwA
- active site: C38 (= C43), H39 (≠ A44), T40 (≠ S45), H43 (= H48), H61 (= H64), E62 (= E65), C92 (≠ D100), C95 (≠ S103), C98 (≠ S106), C106 (≠ Y118), K110 (≠ I125), C148 (= C164), T152 (= T168)
- binding trifluoroethanol: T40 (≠ S45), C148 (= C164), I285 (≠ H303)
- binding zinc ion: C38 (= C43), H61 (= H64), C92 (≠ D100), C95 (≠ S103), C98 (≠ S106), C106 (≠ Y118)
Sites not aligning to the query:
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
29% identity, 93% coverage: 25:357/358 of query aligns to 27:349/357 of P27867
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
28% identity, 94% coverage: 7:344/358 of query aligns to 2:321/337 of 3piiA
- active site: C38 (= C43), H39 (≠ A44), T40 (≠ S45), H43 (= H48), H61 (= H64), E62 (= E65), C92 (≠ D100), C95 (≠ S103), C98 (≠ S106), C106 (≠ Y118), K110 (≠ I125), C148 (= C164), T152 (= T168)
- binding butyramide: T40 (≠ S45), H61 (= H64), W87 (= W94), C148 (= C164)
- binding zinc ion: C38 (= C43), H61 (= H64), E62 (= E65), C92 (≠ D100), C95 (≠ S103), C98 (≠ S106), C106 (≠ Y118), C148 (= C164)
Sites not aligning to the query:
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
27% identity, 93% coverage: 25:357/358 of query aligns to 25:346/354 of P07846
- C43 (= C43) binding
- Y49 (≠ T49) binding
- H67 (= H64) binding
- E68 (= E65) binding
- E153 (≠ N163) binding
- R296 (≠ N304) binding
- Y297 (= Y305) binding
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
27% identity, 93% coverage: 25:357/358 of query aligns to 21:343/351 of 3qe3A
- active site: C39 (= C43), G40 (≠ A44), S41 (= S45), H44 (= H48), H64 (= H64), E65 (= E65), R94 (≠ Q112), D97 (≠ E115), C100 (≠ Y118), S108 (≠ D126), F112 (≠ Q130), P151 (≠ C164), G155 (≠ T168), K339 (≠ R353)
- binding glycerol: Y45 (≠ T49), F54 (≠ C57), T116 (vs. gap), R293 (≠ N304)
- binding zinc ion: C39 (= C43), H64 (= H64), E65 (= E65)
1f8fA Crystal structure of benzyl alcohol dehydrogenase from acinetobacter calcoaceticus
27% identity, 88% coverage: 29:342/358 of query aligns to 27:345/362 of 1f8fA
- active site: C41 (= C43), H42 (≠ A44), T43 (≠ S45), I46 (≠ H48), H62 (= H64), E63 (= E65), C91 (≠ D100), C94 (≠ S103), C97 (≠ S106), C105 (≠ S114), F109 (≠ Y118), C164 (= C164), T168 (= T168)
- binding nicotinamide-adenine-dinucleotide: H42 (≠ A44), C164 (= C164), G191 (= G190), V193 (≠ L192), D213 (= D212), R218 (≠ K217), S256 (≠ T253), T257 (≠ S254), V279 (= V276), V306 (vs. gap), E307 (vs. gap)
- binding zinc ion: C41 (= C43), H62 (= H64), C91 (≠ D100), C94 (≠ S103), C97 (≠ S106), C105 (≠ S114), C164 (= C164)
Sites not aligning to the query:
1pl6A Human sdh/nadh/inhibitor complex (see paper)
28% identity, 93% coverage: 25:357/358 of query aligns to 26:348/356 of 1pl6A
- active site: C44 (= C43), G45 (≠ A44), S46 (= S45), H49 (= H48), H69 (= H64), E70 (= E65), R99 (≠ Q112), D102 (≠ E115), C105 (≠ Y118), S113 (≠ D126), F117 (≠ Q130), P156 (≠ C164), G160 (≠ T168), K344 (≠ R353)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C43), S46 (= S45), I56 (≠ R54), F59 (≠ C57), H69 (= H64), E155 (≠ N163), L274 (≠ I287), F297 (≠ H303)
- binding nicotinamide-adenine-dinucleotide: G181 (= G190), P182 (≠ M191), I183 (≠ L192), D203 (= D212), L204 (= L213), R208 (≠ K217), C249 (≠ T253), T250 (≠ S254), V272 (= V276), G273 (= G277), L274 (≠ I287), F297 (≠ H303), R298 (≠ N304)
- binding zinc ion: C44 (= C43), H69 (= H64)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
26% identity, 96% coverage: 7:350/358 of query aligns to 4:331/341 of 3meqA
- active site: C40 (= C43), H41 (≠ A44), T42 (≠ S45), H45 (= H48), H63 (= H64), E64 (= E65), C94 (≠ D100), C97 (≠ S103), C100 (≠ S106), C108 (≠ S114), L112 (≠ I125), C150 (= C164), T154 (= T168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C43), H41 (≠ A44), T42 (≠ S45), H45 (= H48), C150 (= C164), T154 (= T168), G176 (= G190), G177 (≠ M191), L178 (= L192), D197 (= D212), I198 (≠ L213), K202 (= K217), T241 (= T253), A242 (≠ S254), V243 (≠ G255), S244 (≠ M256), A247 (= A259), N264 (≠ V276), G265 (= G277), L266 (≠ F280), I289 (≠ H303), V290 (≠ N304)
- binding zinc ion: C40 (= C43), H63 (= H64), C94 (≠ D100), C97 (≠ S103), C100 (≠ S106), C108 (≠ S114), C150 (= C164)
Sites not aligning to the query:
5tnxA Crystal structure of alcohol dehydrogenase zinc-binding domain protein from burkholderia ambifaria
25% identity, 93% coverage: 17:349/358 of query aligns to 16:359/370 of 5tnxA
- active site: C42 (= C43), H43 (≠ A44), T44 (≠ S45), I47 (≠ H48), H63 (= H64), E64 (= E65), C92 (≠ Y97), C95 (≠ D100), C98 (≠ S103), C106 (≠ P111), F110 (vs. gap), C171 (= C164), T175 (= T168)
- binding zinc ion: C92 (≠ Y97), C95 (≠ D100), C98 (≠ S103), C106 (≠ P111)
Sites not aligning to the query:
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
24% identity, 93% coverage: 21:354/358 of query aligns to 18:341/346 of 2dfvA
- active site: C40 (= C43), G41 (≠ A44), T42 (≠ S45), H45 (= H48), H65 (= H64), E66 (= E65), C95 (≠ D100), C98 (≠ S103), C101 (≠ S106), C109 (≠ S114), K113 (≠ Y118), P151 (= P161), A155 (≠ T165), K340 (≠ R353)
- binding nicotinamide-adenine-dinucleotide: G175 (= G190), P176 (≠ M191), L177 (= L192), E197 (≠ D212), P198 (≠ L213), R202 (≠ K217), F241 (≠ T253), S242 (= S254), A244 (≠ M256), L264 (≠ V276), G265 (= G277), L266 (≠ V279), I289 (≠ L302), T290 (≠ H303)
- binding zinc ion: C95 (≠ D100), C101 (≠ S106), C109 (≠ S114)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
24% identity, 93% coverage: 21:354/358 of query aligns to 20:343/348 of O58389
- C42 (= C43) binding
- T44 (≠ S45) mutation to A: Total loss of enzymatic activity.
- H67 (= H64) binding
- E68 (= E65) binding
- C97 (≠ D100) binding
- C100 (≠ S103) binding
- C103 (≠ S106) binding
- C111 (≠ S114) binding
- E152 (vs. gap) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (= L192) binding
- E199 (≠ D212) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (≠ K217) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LG-L 266:268 (≠ VGAV 276:279) binding
- IT 291:292 (≠ LH 302:303) binding
- R294 (≠ N304) mutation to A: 4000-fold decrease in catalytic efficiency.
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
26% identity, 93% coverage: 21:354/358 of query aligns to 20:343/350 of Q5JI69
- L179 (= L192) binding
- E199 (≠ D212) binding
- R204 (≠ K217) binding
- LG-L 266:268 (≠ VGAV 276:279) binding
- IT 291:292 (vs. gap) binding
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
28% identity, 93% coverage: 25:357/358 of query aligns to 27:349/357 of Q00796
- C45 (= C43) binding
- H70 (= H64) binding
- E71 (= E65) binding
- R110 (≠ H122) to P: in SORDD; results in protein aggregation
- H135 (≠ R142) to R: in SORDD; results in protein aggregation
- A153 (= A160) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (≠ L192) binding
- D204 (= D212) binding
- R209 (≠ K217) binding
- Q239 (vs. gap) to L: in dbSNP:rs1042079
- N269 (≠ T272) to T: in dbSNP:rs930337
- VG---------L 273:275 (≠ VGAVFPQRNLSI 276:287) binding
- VFR 297:299 (≠ LHN 302:304) binding
- V322 (= V330) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
26% identity, 93% coverage: 21:354/358 of query aligns to 18:341/347 of 3gfbA
- active site: C40 (= C43), G41 (≠ A44), T42 (≠ S45), H45 (= H48), H65 (= H64), E66 (= E65), C95 (≠ A102), C98 (≠ G109), C101 (≠ Q112), C109 (≠ Y120), K113 (≠ Q124), P151 (= P161), A155 (≠ T165), K340 (≠ R353)
- binding nicotinamide-adenine-dinucleotide: G173 (= G188), G175 (= G190), P176 (≠ M191), L177 (= L192), S196 (≠ C211), E197 (≠ D212), P198 (≠ L213), R202 (≠ K217), F241 (≠ T253), S242 (= S254), A244 (≠ M256), L264 (≠ V276), G265 (= G277), L266 (≠ V279), I289 (vs. gap), T290 (vs. gap)
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
26% identity, 98% coverage: 4:354/358 of query aligns to 2:331/336 of 6z42A
- active site: C41 (= C43), T43 (≠ S45), H46 (= H48), H64 (= H64), C148 (= C164)
- binding zinc ion: C41 (= C43), H64 (= H64), E65 (= E65), C95 (≠ D100), C98 (≠ S103), C101 (≠ S106), C109 (≠ S114), C148 (= C164)
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
27% identity, 92% coverage: 23:350/358 of query aligns to 18:327/345 of 4z6kA
- active site: C38 (= C43), H39 (≠ A44), T40 (≠ S45), H43 (= H48), H61 (= H64), E62 (= E65), C92 (≠ D100), C95 (≠ S103), C98 (≠ S106), C106 (≠ S114), Q110 (≠ I125), C148 (= C164), T152 (= T168)
- binding zinc ion: C38 (= C43), H61 (= H64), C92 (≠ D100), C95 (≠ S103), C98 (≠ S106), C106 (≠ S114), C148 (= C164)
Sites not aligning to the query:
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
30% identity, 72% coverage: 23:278/358 of query aligns to 17:268/346 of 4cpdA
- active site: C38 (= C43), G39 (≠ A44), S40 (= S45), H43 (= H48), H59 (= H64), E60 (= E65), C89 (≠ D100), C92 (≠ S103), C95 (≠ S106), C103 (≠ S114), G107 (≠ Y118), D152 (≠ C164), T156 (= T168)
- binding nicotinamide-adenine-dinucleotide: G39 (≠ A44), S40 (= S45), T156 (= T168), G178 (= G190), P179 (≠ M191), V180 (≠ L192), D200 (= D212), R201 (≠ L213), R205 (≠ K217), A243 (≠ T253), V244 (≠ S254), V266 (= V276), V268 (≠ A278)
- binding zinc ion: C38 (= C43), H59 (= H64), C89 (≠ D100), C92 (≠ S103), C95 (≠ S106), C103 (≠ S114), D152 (≠ C164)
Sites not aligning to the query:
Query Sequence
>Echvi_4558 FitnessBrowser__Cola:Echvi_4558
MNASPAKAMLFTAANTPFSSLSVAFPSLQKGEILVRNLYATICASDLHTFHGRRKSCHHS
VLGHEIVGRIEALAEEGAKDYHGRPLEKGDRITWSVYAHDPASPTSLKGFPQKSEDLYKY
GHEQIDDHYQLNGGFSTHCHLRKGTSLFKLPEALTDREAAPLNCTHATIAGAMRLAGSLS
GKTVLVNGAGMLGLSACAMAKEKGASHVWACDLSIEKATHAKAFGADTAFEAESKDVPHR
IFGPDKADIIIETSGMPEAMENCLHMLGIGGTIILVGAVFPQRNLSINAEFLVRNLLTIK
GLHNYIPEDLATAISFLTKAKAKYPFDSLVGREFSLEQLDSAFEAGSHGKYYRVGVKP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory