Comparing GFF100 FitnessBrowser__psRCH2:GFF100 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 83% coverage: 5:232/276 of query aligns to 2:224/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
38% identity, 83% coverage: 5:232/276 of query aligns to 2:224/230 of 1l2tA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
39% identity, 84% coverage: 5:235/276 of query aligns to 3:218/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
35% identity, 87% coverage: 5:243/276 of query aligns to 4:228/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
35% identity, 87% coverage: 5:243/276 of query aligns to 4:228/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
35% identity, 87% coverage: 5:243/276 of query aligns to 4:228/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
35% identity, 87% coverage: 5:243/276 of query aligns to 4:228/242 of 2oljA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
38% identity, 79% coverage: 18:234/276 of query aligns to 21:223/226 of 5xu1B
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 96% coverage: 5:268/276 of query aligns to 2:261/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 96% coverage: 5:268/276 of query aligns to 3:262/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 96% coverage: 5:268/276 of query aligns to 3:262/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 96% coverage: 5:268/276 of query aligns to 3:262/344 of 6cvlD
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
35% identity, 83% coverage: 5:234/276 of query aligns to 4:223/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
35% identity, 83% coverage: 5:234/276 of query aligns to 4:223/592 of 5lj7A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
35% identity, 82% coverage: 5:231/276 of query aligns to 4:216/223 of 2pclA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 88% coverage: 5:247/276 of query aligns to 2:230/240 of 4ymuJ
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
37% identity, 83% coverage: 5:232/276 of query aligns to 2:216/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
37% identity, 83% coverage: 5:232/276 of query aligns to 2:216/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
36% identity, 83% coverage: 5:232/276 of query aligns to 2:216/218 of 8hd0A
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
37% identity, 83% coverage: 5:234/276 of query aligns to 3:220/225 of 8iddA
>GFF100 FitnessBrowser__psRCH2:GFF100
MNAAIRVERLNKTFAGKQALFDLGLAVQPGEMVALIGASGSGKSTLLRHLAGLACCDSSA
GGRIEVLGREVQATGRLHGEVRRLRADIGYIFQQFNLVTRLSVLDNVLLGFLGRMPRWRG
SLGMFSDEQKRQAMAALERVGLAERAAQRASTLSGGQQQRVAIARALTQQAEVILADEPI
ASLDPESARKVMEILADINRQDGKTVVVTLHQVDYALRYCSRAVALKGGRIHYDGPSAAL
SDRLLNDLYGADLDASLLFSDRARSAEPRQLQLVNG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory