Comparing GFF1015 FitnessBrowser__Phaeo:GFF1015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3u9sF Crystal structure of p. Aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex (see paper)
68% identity, 100% coverage: 2:527/527 of query aligns to 12:537/537 of 3u9sF
8f3dA 3-methylcrotonyl-coa carboxylase in filament, beta-subunit centered (see paper)
59% identity, 92% coverage: 34:516/527 of query aligns to 76:566/566 of 8f3dA
Q168G2 Propionyl-CoA carboxylase beta chain; EC 6.4.1.3 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
34% identity, 95% coverage: 16:518/527 of query aligns to 3:499/510 of Q168G2
3n6rB Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
34% identity, 95% coverage: 18:518/527 of query aligns to 1:495/506 of 3n6rB
1vrgA Crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution
31% identity, 94% coverage: 16:512/527 of query aligns to 5:498/515 of 1vrgA
1on3C Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
34% identity, 93% coverage: 20:509/527 of query aligns to 11:490/510 of 1on3C
1on3E Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
33% identity, 93% coverage: 20:509/527 of query aligns to 15:500/520 of 1on3E
8pn7A Engineered glycolyl-coa carboxylase (g20r variant) with bound coa (see paper)
33% identity, 96% coverage: 18:521/527 of query aligns to 1:498/506 of 8pn7A
7ybuP Human propionyl-coenzyme a carboxylase
32% identity, 93% coverage: 20:509/527 of query aligns to 6:487/507 of 7ybuP
3ib9A Propionyl-coa carboxylase beta subunit, d422l (see paper)
31% identity, 92% coverage: 18:502/527 of query aligns to 9:494/521 of 3ib9A
1xnyA Biotin and propionyl-coa bound to acyl-coa carboxylase beta subunit from s. Coelicolor (pccb) (see paper)
31% identity, 92% coverage: 18:502/527 of query aligns to 9:494/521 of 1xnyA
8sgxE Leishmania tarentolae propionyl-coa carboxylase (alpha-4-beta-6) (see paper)
32% identity, 88% coverage: 39:502/527 of query aligns to 8:462/489 of 8sgxE
5iniF Structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics (see paper)
30% identity, 95% coverage: 16:514/527 of query aligns to 4:496/511 of 5iniF
3gf3A Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co- crystallized with glutaconyl-coa (see paper)
25% identity, 94% coverage: 21:516/527 of query aligns to 36:541/563 of 3gf3A
3gmaB Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co- crystallized with glutaryl-coa (see paper)
25% identity, 94% coverage: 21:516/527 of query aligns to 36:545/566 of 3gmaB
4g2rB Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor haloxyfop from mycobacterium tuberculosis (see paper)
31% identity, 70% coverage: 81:450/527 of query aligns to 27:380/441 of 4g2rB
6tzvA Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis
29% identity, 75% coverage: 56:450/527 of query aligns to 1:365/426 of 6tzvA
6prwA Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p derivative from mycobacterium tuberculosis
29% identity, 75% coverage: 56:450/527 of query aligns to 1:365/426 of 6prwA
6pk2A Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p derivative from mycobacterium tuberculosis
29% identity, 75% coverage: 56:450/527 of query aligns to 1:365/426 of 6pk2A
6p7uA Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p from mycobacterium tuberculosis
29% identity, 75% coverage: 56:450/527 of query aligns to 1:365/426 of 6p7uA
>GFF1015 FitnessBrowser__Phaeo:GFF1015
MPSSEGFKQNREAHLDALGQISEAAETARMGGGEKSRARHESRGKMLPRRRVANLLDPGS
PFLEIGATAAHAMYDGAAPGAGVVAGIGRVHGQEVMVVCNDATVKGGTYFPMTVKKHLRA
QEIAEENRLPCIYLVDSGGANLPQQDEVFPDRDHFGRIFYNQARMSAKGIAQIAVVMGSC
TAGGAYVPAMSDVTIIVKEQGTIFLAGPPLVKAATGEVVSAEDLGGGDVHTRLSGVADYL
AEDDAHALALARRAVQSLNITKPLTVNWASPEEPAYDPEEILGVVPGDLRTPYDIREVIA
RLVDGSRFDEFKPRFGETLVTGFAHVKGCPVGIIANNGVLFSEAAQKGAHFVELCSQRKI
PLVFLQNITGFMVGRKYENEGIARHGAKMVTAVATTNVPKVTMLVGGSFGAGNYGMSGRA
YQPRFLWSWPNSRISVMGGEQAAGVLATVKRDAIERQGGSWSTEEEASFKQPTIDMFEEQ
SHPLYASARLWDDGIIDPRKSRDVLALSLSAALNAPIEDTRFGVFRM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory