SitesBLAST
Comparing GFF1035 FitnessBrowser__Marino:GFF1035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 69% coverage: 8:216/302 of query aligns to 6:211/393 of P9WQI3
- H193 (= H198) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
37% identity, 65% coverage: 21:216/302 of query aligns to 17:219/375 of 2d62A
1g291 Malk (see paper)
36% identity, 65% coverage: 21:216/302 of query aligns to 14:216/372 of 1g291
- binding magnesium ion: D69 (≠ G76), E71 (= E80), K72 (≠ R81), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S45), G39 (= G46), C40 (= C47), G41 (= G48), K42 (= K49), T43 (≠ S50), T44 (= T51)
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 69% coverage: 21:227/302 of query aligns to 13:220/374 of 2awnB
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
36% identity, 69% coverage: 21:227/302 of query aligns to 14:221/371 of P68187
- A85 (≠ S89) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ E110) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ S120) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ Y123) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ K125) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ D130) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G143) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D164) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
36% identity, 69% coverage: 21:227/302 of query aligns to 13:220/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S45), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (= S50), T43 (= T51), Q81 (= Q86), R128 (= R135), A132 (≠ Q139), S134 (= S141), G136 (= G143), Q137 (≠ M144), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (= S50), Q81 (= Q86)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
36% identity, 69% coverage: 21:227/302 of query aligns to 13:220/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (= S50), T43 (= T51), R128 (= R135), S134 (= S141), Q137 (≠ M144)
- binding beryllium trifluoride ion: S37 (= S45), G38 (= G46), K41 (= K49), Q81 (= Q86), S134 (= S141), G136 (= G143), H191 (= H198)
- binding magnesium ion: S42 (= S50), Q81 (= Q86)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
36% identity, 69% coverage: 21:227/302 of query aligns to 13:220/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (= V25), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (= S50), T43 (= T51), R128 (= R135), A132 (≠ Q139), S134 (= S141), Q137 (≠ M144)
- binding tetrafluoroaluminate ion: S37 (= S45), G38 (= G46), K41 (= K49), Q81 (= Q86), S134 (= S141), G135 (= G142), G136 (= G143), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (= S50), Q81 (= Q86)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
36% identity, 69% coverage: 21:227/302 of query aligns to 13:220/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (= V25), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (= S50), T43 (= T51), R128 (= R135), A132 (≠ Q139), S134 (= S141), Q137 (≠ M144)
- binding magnesium ion: S42 (= S50), Q81 (= Q86)
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
36% identity, 69% coverage: 21:227/302 of query aligns to 11:218/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S45), G36 (= G46), C37 (= C47), G38 (= G48), K39 (= K49), S40 (= S50), T41 (= T51), R126 (= R135), A130 (≠ Q139), S132 (= S141), G134 (= G143), Q135 (≠ M144)
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 70% coverage: 5:216/302 of query aligns to 17:224/378 of P69874
- C26 (≠ V14) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y15) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F38) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C47) mutation to T: Loss of ATPase activity and transport.
- L60 (= L53) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ M69) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V127) mutation to M: Loss of ATPase activity and transport.
- D172 (= D164) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
8hprC Lpqy-sugabc in state 4 (see paper)
36% identity, 69% coverage: 8:216/302 of query aligns to 5:210/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y15), S38 (= S45), G39 (= G46), G41 (= G48), K42 (= K49), S43 (= S50), Q82 (= Q86), Q133 (= Q139), G136 (= G142), G137 (= G143), Q138 (≠ M144), H192 (= H198)
- binding magnesium ion: S43 (= S50), Q82 (= Q86)
8hprD Lpqy-sugabc in state 4 (see paper)
36% identity, 69% coverage: 8:216/302 of query aligns to 5:210/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y15), S38 (= S45), C40 (= C47), G41 (= G48), K42 (= K49), S43 (= S50), T44 (= T51), Q82 (= Q86), R129 (= R135), Q133 (= Q139), S135 (= S141), G136 (= G142), G137 (= G143), Q159 (≠ E165), H192 (= H198)
- binding magnesium ion: S43 (= S50), Q82 (= Q86)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 75% coverage: 28:253/302 of query aligns to 44:265/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39, 40, 41
7aheC Opua inhibited inward facing (see paper)
33% identity, 75% coverage: 28:253/302 of query aligns to 44:265/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 69% coverage: 21:227/302 of query aligns to 14:221/369 of P19566
- L86 (= L90) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P166) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D171) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
8hplC Lpqy-sugabc in state 1 (see paper)
36% identity, 69% coverage: 8:216/302 of query aligns to 5:208/384 of 8hplC
7ahdC Opua (e190q) occluded (see paper)
35% identity, 65% coverage: 28:222/302 of query aligns to 44:245/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (= S45), G62 (= G46), G64 (= G48), K65 (= K49), S66 (= S50), T67 (= T51), Q111 (= Q86), K161 (≠ S138), Q162 (= Q139), S164 (= S141), G166 (= G143), M167 (= M144), Q188 (≠ E165), H221 (= H198)
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
37% identity, 70% coverage: 1:210/302 of query aligns to 1:216/233 of P75957
- G42 (= G43) mutation to D: Loss of lipoprotein release when overexpressed.
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
33% identity, 69% coverage: 21:227/302 of query aligns to 17:216/353 of 1vciA
Sites not aligning to the query:
Query Sequence
>GFF1035 FitnessBrowser__Marino:GFF1035
MSKSFLEVDGLSKVYPDGQGGELTVFEDIRFALEKGEFVCIIGHSGCGKSTILNVLAGLD
EASAGNVVMNGKEIKGPGLERGVVFQNYSLLPWKTTLNNIVFAVRARWPEWSKEKVKEHS
ERYLKMVGLDHALNRKPSQLSGGMRQRVSIARAFATQPELLLLDEPFGALDALTRGVIQD
ELVKIWEETRQTVFMITHDVDEAILLSDRIFLMSNGPNARIAESVKVDIPHPRARATIFQ
NPAYHKTRDYLVDFLVNRSGSALPEKDGTPKIVEPAQGVAQSGPASDESETESETAARAV
NA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory