SitesBLAST
Comparing GFF1039 FitnessBrowser__WCS417:GFF1039 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 97% coverage: 4:249/253 of query aligns to 6:247/247 of 4jroC
- active site: G16 (= G14), S142 (= S139), Q152 (≠ H150), Y155 (= Y153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ A12), R15 (≠ S13), G16 (= G14), I17 (= I15), N35 (≠ G33), Y36 (= Y34), N37 (≠ P36), G38 (≠ A37), S39 (≠ D38), N63 (≠ D62), V64 (= V63), N90 (= N89), A91 (= A90), I93 (≠ L92), I113 (≠ V112), S142 (= S139), Y155 (= Y153), K159 (= K157), P185 (= P183), I188 (= I186), T190 (= T188)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
36% identity, 96% coverage: 4:247/253 of query aligns to 5:244/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 96% coverage: 4:247/253 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G14), S138 (= S139), Q148 (≠ H150), Y151 (= Y153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (≠ A12), R11 (≠ S13), I13 (= I15), N31 (≠ G33), Y32 (= Y34), A33 (≠ P36), G34 (≠ A37), S35 (≠ D38), A58 (≠ L61), N59 (≠ D62), V60 (= V63), N86 (= N89), A87 (= A90), T109 (≠ V112), S138 (= S139), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
38% identity, 96% coverage: 4:247/253 of query aligns to 6:241/244 of 6t77A
- active site: G16 (= G14), S138 (= S139), Y151 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ A12), R15 (≠ S13), T37 (≠ D38), L58 (= L59), N59 (≠ D62), V60 (= V63), A87 (= A90), G88 (= G91), I89 (≠ L92)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 96% coverage: 4:247/253 of query aligns to 6:241/244 of P0A2C9
- M125 (= M128) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ T229) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S230) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
37% identity, 97% coverage: 5:249/253 of query aligns to 3:244/244 of 1edoA
- active site: G12 (= G14), S138 (= S139), Y151 (= Y153), K155 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (≠ A12), R11 (≠ S13), I13 (= I15), N31 (≠ G33), Y32 (= Y34), A33 (≠ Y35), R34 (≠ P36), S35 (≠ A37), D59 (= D62), V60 (= V63), N86 (= N89), A87 (= A90), S138 (= S139), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), I184 (= I186), S186 (≠ T188), M188 (≠ A194)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 96% coverage: 4:247/253 of query aligns to 5:240/243 of 1q7bA
- active site: G15 (= G14), E101 (≠ L105), S137 (= S139), Q147 (≠ H150), Y150 (= Y153), K154 (= K157)
- binding calcium ion: E232 (≠ Q239), T233 (≠ S240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), S13 (≠ A12), R14 (≠ S13), T36 (≠ D38), N58 (≠ D62), V59 (= V63), N85 (= N89), A86 (= A90), G87 (= G91), I88 (≠ L92), S137 (= S139), Y150 (= Y153), K154 (= K157), P180 (= P183), G181 (= G184), I183 (= I186)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 96% coverage: 4:247/253 of query aligns to 6:241/244 of P0AEK2
- GASR 12:15 (≠ GAAS 10:13) binding
- T37 (≠ D38) binding
- NV 59:60 (≠ DV 62:63) binding
- N86 (= N89) binding
- Y151 (= Y153) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (= YAAAK 153:157) binding
- A154 (= A156) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K157) mutation to A: Defect in the affinity for NADPH.
- I184 (= I186) binding
- E233 (≠ Q239) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
34% identity, 100% coverage: 1:252/253 of query aligns to 11:260/267 of 3ay6B
- active site: G24 (= G14), S151 (= S139), Y164 (= Y153), K168 (= K157)
- binding beta-D-glucopyranose: E102 (≠ L93), S151 (= S139), H153 (≠ A141), W158 (= W147), Y164 (= Y153), N202 (≠ D193), K205 (≠ N196)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G10), T23 (≠ S13), G24 (= G14), L25 (≠ I15), Y45 (= Y35), D71 (= D62), V72 (= V63), N98 (= N89), A99 (= A90), G100 (= G91), V101 (≠ L92), M149 (≠ I137), S151 (= S139), Y164 (= Y153), K168 (= K157), P194 (= P183), G195 (= G184), M197 (≠ I186), T199 (= T188), P200 (= P189), I201 (≠ L192), N202 (≠ D193)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
37% identity, 96% coverage: 4:247/253 of query aligns to 5:240/243 of 1q7cA
- active site: G15 (= G14), S137 (= S139), Q147 (≠ H150), F150 (≠ Y153), K154 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), S13 (≠ A12), R14 (≠ S13), A35 (= A37), T36 (≠ D38), L57 (= L59), N58 (≠ D62), V59 (= V63), G87 (= G91), I88 (≠ L92)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
37% identity, 98% coverage: 1:247/253 of query aligns to 4:244/247 of P73574
- A14 (= A11) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ Q148) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K157) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ L185) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ G199) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
38% identity, 96% coverage: 4:247/253 of query aligns to 6:237/239 of 4nbtA
- active site: G16 (= G14), S132 (= S139), Y145 (= Y153), K149 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), K15 (≠ S13), G16 (= G14), L17 (≠ I15), D36 (= D38), L37 (≠ P39), L52 (= L61), N53 (≠ D62), V54 (= V63), N80 (= N89), A81 (= A90), G82 (= G91), I130 (= I137), S132 (= S139), Y145 (= Y153), K149 (= K157), P177 (= P183), G178 (= G184), I180 (= I186), T182 (= T188)
Q73SC8 Uncharacterized NAD-dependent oxidoreductase MAP_4146; EC 1.-.-.- from Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis)
38% identity, 96% coverage: 4:246/253 of query aligns to 11:271/275 of Q73SC8
3pgxA Crystal structure of a putative carveol dehydrogenase from mycobacterium paratuberculosis bound to nicotinamide adenine dinucleotide (see paper)
38% identity, 96% coverage: 4:246/253 of query aligns to 6:266/270 of 3pgxA
- active site: G16 (= G14), S155 (= S139), Y168 (= Y153), K172 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), R15 (≠ S13), G16 (= G14), Q17 (≠ I15), D36 (vs. gap), I37 (vs. gap), A50 (= A37), D75 (= D62), V76 (= V63), N102 (= N89), A103 (= A90), G104 (= G91), V105 (≠ L92), V125 (= V112), V153 (≠ I137), Y168 (= Y153), K172 (= K157), P198 (= P183), V201 (≠ I186), T203 (= T188), M205 (≠ Q190), I206 (≠ L198)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
38% identity, 98% coverage: 4:251/253 of query aligns to 6:255/256 of 7do7A
- active site: G16 (= G14), S146 (= S139), Y159 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), R15 (≠ S13), G16 (= G14), I17 (= I15), S37 (≠ Y35), D66 (= D62), A67 (≠ V63), N93 (= N89), A94 (= A90), G95 (= G91), I96 (≠ L92), V144 (≠ I137), S145 (= S138), S146 (= S139), Y159 (= Y153), K163 (= K157), P189 (= P183), G190 (= G184), I192 (= I186), T194 (= T188), I196 (≠ Q190)
- binding beta-L-rhamnopyranose: F99 (≠ R95), S146 (= S139), S148 (≠ A141), Q156 (≠ E149), Y159 (= Y153), N197 (≠ S191), D235 (= D231), M236 (≠ A232), R238 (≠ S234)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
38% identity, 98% coverage: 4:251/253 of query aligns to 6:255/256 of 7b81A
- active site: G16 (= G14), S146 (= S139), Y159 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), S14 (≠ A12), R15 (≠ S13), I17 (= I15), D66 (= D62), A67 (≠ V63), N93 (= N89), A94 (= A90), G95 (= G91), I96 (≠ L92), T116 (≠ V112), V144 (≠ I137), S146 (= S139), Y159 (= Y153), K163 (= K157), P189 (= P183), G190 (= G184), I192 (= I186), T194 (= T188), I196 (≠ Q190)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
33% identity, 98% coverage: 4:252/253 of query aligns to 8:254/261 of 1g6kA
- active site: G18 (= G14), S145 (= S139), Y158 (= Y153), K162 (= K157)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S13), G18 (= G14), L19 (≠ I15), R39 (≠ Y35), D65 (= D62), V66 (= V63), N92 (= N89), A93 (= A90), G94 (= G91), M143 (≠ I137), S145 (= S139), Y158 (= Y153), P188 (= P183), G189 (= G184), I191 (= I186), T193 (= T188)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
33% identity, 98% coverage: 4:252/253 of query aligns to 8:254/261 of P40288
- 11:35 (vs. 7:31, 36% identical) binding
- E96 (≠ L93) mutation E->A,G,K: Heat stable.
- D108 (≠ L105) mutation to N: Heat stable.
- V112 (≠ M109) mutation to A: Heat stable.
- E133 (= E130) mutation to K: Heat stable.
- V183 (≠ C178) mutation to I: Heat stable.
- P194 (= P189) mutation to Q: Heat stable.
- E210 (≠ A207) mutation to K: Heat stable.
- Y217 (≠ R214) mutation to H: Heat stable.
- Q252 (≠ R250) mutation to L: Heat stable.
- Y253 (≠ W251) mutation to C: Heat stable.
Sites not aligning to the query:
- 258 A→G: Heat stable.
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
38% identity, 96% coverage: 4:247/253 of query aligns to 19:252/255 of 4bo4C
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
37% identity, 98% coverage: 1:249/253 of query aligns to 3:245/248 of Q9KJF1
- S15 (= S13) binding
- D36 (≠ P36) binding
- D62 (= D62) binding
- I63 (≠ V63) binding
- N89 (= N89) binding
- Y153 (= Y153) binding
- K157 (= K157) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>GFF1039 FitnessBrowser__WCS417:GFF1039
MSRKVALITGAASGIGQALAVAYARNGVAVVGGYYPADPHDPQTTVSLVEEAGGECLMLP
LDVGDTASVDALAAQTIQHFGRLDYAVANAGLLRRAPLLEMTDALWDEMLNVDLTGVMRT
FRAATRHMQEGGALVAISSIAGGVYGWQEHSHYAAAKAGVPGLCRSLAVELAAKGIRCNA
VIPGLIETPQSLDAKNSLGPEGLAKAARAIPLGRVGRADEVASLVQFLTSDASSYLTGQS
IVIDGGLTVRWPD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory