SitesBLAST
Comparing GFF1051 FitnessBrowser__Phaeo:GFF1051 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 75% coverage: 16:298/375 of query aligns to 12:302/378 of P69874
- C26 (≠ F30) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F31) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ V49) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C58) mutation to T: Loss of ATPase activity and transport.
- L60 (= L64) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V80) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V140) mutation to M: Loss of ATPase activity and transport.
- D172 (= D177) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ F272) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (≠ Q293) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
39% identity, 79% coverage: 22:316/375 of query aligns to 4:296/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (= F31), Q14 (≠ D32), T16 (≠ R34), V18 (= V36), S38 (= S56), G39 (= G57), C40 (= C58), G41 (= G59), K42 (= K60), T43 (≠ S61), T44 (= T62), R133 (≠ E148), E137 (≠ Q152), S139 (= S154), G141 (= G156), Q142 (≠ E157)
- binding calcium ion: T43 (≠ S61), Q86 (= Q104)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
42% identity, 68% coverage: 22:275/375 of query aligns to 7:266/375 of 2d62A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 93% coverage: 22:371/375 of query aligns to 4:353/369 of P19566
- L86 (= L108) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P179) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D184) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- E306 (≠ R324) mutation to K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1g291 Malk (see paper)
42% identity, 70% coverage: 26:286/375 of query aligns to 8:274/372 of 1g291
- binding magnesium ion: D69 (= D87), E71 (vs. gap), K72 (vs. gap), K79 (≠ E95), D80 (≠ R96)
- binding pyrophosphate 2-: S38 (= S56), G39 (= G57), C40 (= C58), G41 (= G59), K42 (= K60), T43 (≠ S61), T44 (= T62)
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
34% identity, 93% coverage: 22:371/375 of query aligns to 3:354/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F31), S37 (= S56), G38 (= G57), C39 (= C58), G40 (= G59), K41 (= K60), S42 (= S61), T43 (= T62), Q81 (= Q104), R128 (≠ E148), A132 (≠ Q152), S134 (= S154), G136 (= G156), Q137 (≠ E157), E158 (= E178), H191 (= H211)
- binding magnesium ion: S42 (= S61), Q81 (= Q104)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
34% identity, 93% coverage: 22:371/375 of query aligns to 3:354/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F31), G38 (= G57), C39 (= C58), G40 (= G59), K41 (= K60), S42 (= S61), T43 (= T62), R128 (≠ E148), S134 (= S154), Q137 (≠ E157)
- binding beryllium trifluoride ion: S37 (= S56), G38 (= G57), K41 (= K60), Q81 (= Q104), S134 (= S154), G136 (= G156), H191 (= H211)
- binding magnesium ion: S42 (= S61), Q81 (= Q104)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
34% identity, 93% coverage: 22:371/375 of query aligns to 3:354/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F31), V17 (= V36), G38 (= G57), C39 (= C58), G40 (= G59), K41 (= K60), S42 (= S61), T43 (= T62), R128 (≠ E148), A132 (≠ Q152), S134 (= S154), Q137 (≠ E157)
- binding tetrafluoroaluminate ion: S37 (= S56), G38 (= G57), K41 (= K60), Q81 (= Q104), S134 (= S154), G135 (= G155), G136 (= G156), E158 (= E178), H191 (= H211)
- binding magnesium ion: S42 (= S61), Q81 (= Q104)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
34% identity, 93% coverage: 22:371/375 of query aligns to 3:354/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F31), V17 (= V36), G38 (= G57), C39 (= C58), G40 (= G59), K41 (= K60), S42 (= S61), T43 (= T62), R128 (≠ E148), A132 (≠ Q152), S134 (= S154), Q137 (≠ E157)
- binding magnesium ion: S42 (= S61), Q81 (= Q104)
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 75% coverage: 21:300/375 of query aligns to 3:286/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 75% coverage: 21:300/375 of query aligns to 3:286/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 75% coverage: 21:300/375 of query aligns to 3:286/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
36% identity, 75% coverage: 21:300/375 of query aligns to 3:286/353 of Q97UY8
- S142 (= S154) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G156) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E178) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
34% identity, 93% coverage: 22:371/375 of query aligns to 4:355/371 of P68187
- A85 (= A107) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (= K126) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V133) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L136) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ R138) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S143) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G156) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D177) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R247) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (= F253) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- W267 (≠ L276) mutation to G: Normal maltose transport but constitutive mal gene expression.
- G278 (= G283) mutation to P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- S282 (≠ D287) mutation to L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G284 (≠ V289) mutation to S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G302 (= G318) mutation to D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- E308 (≠ R324) mutation to Q: Maltose transport is affected but retains ability to interact with MalT.
- S322 (≠ F338) mutation to F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G340 (= G356) mutation to A: Maltose transport is affected but retains ability to interact with MalT.
- G346 (≠ T362) mutation to S: Normal maltose transport but constitutive mal gene expression.
- F355 (= F371) mutation to Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
34% identity, 93% coverage: 22:371/375 of query aligns to 3:354/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
34% identity, 93% coverage: 22:371/375 of query aligns to 1:352/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F31), S35 (= S56), G36 (= G57), C37 (= C58), G38 (= G59), K39 (= K60), S40 (= S61), T41 (= T62), R126 (≠ E148), A130 (≠ Q152), S132 (= S154), G134 (= G156), Q135 (≠ E157)
3d31A Modbc from methanosarcina acetivorans (see paper)
36% identity, 73% coverage: 22:295/375 of query aligns to 2:276/348 of 3d31A
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 72% coverage: 28:296/375 of query aligns to 11:288/393 of P9WQI3
- H193 (= H211) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 72% coverage: 25:295/375 of query aligns to 7:286/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F30), S38 (= S56), C40 (= C58), G41 (= G59), K42 (= K60), S43 (= S61), T44 (= T62), Q82 (= Q104), R129 (≠ E148), Q133 (= Q152), S135 (= S154), G136 (= G155), G137 (= G156), Q159 (≠ E178), H192 (= H211)
- binding magnesium ion: S43 (= S61), Q82 (= Q104)
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 72% coverage: 25:295/375 of query aligns to 7:286/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ F30), S38 (= S56), G39 (= G57), G41 (= G59), K42 (= K60), S43 (= S61), Q82 (= Q104), Q133 (= Q152), G136 (= G155), G137 (= G156), Q138 (≠ E157), H192 (= H211)
- binding magnesium ion: S43 (= S61), Q82 (= Q104)
Query Sequence
>GFF1051 FitnessBrowser__Phaeo:GFF1051
MTSSPPDPMLGTNSASAPAPRLEIRNLRRFFDGRAVVDDVSLQIQAGQVTCLLGPSGCGK
STTLRMIAGVEMQDSGEIYVDGKLICDTVFRVPPERREIGLMFQDFALFPHLSVADNVAF
GLKGSKDEKRARVEELLRKVSLSQYIDEFPHQLSGGEQQRVALARALAPRPRIMLMDEPF
SGLDNRLRDGIRDETLTLLKEEGAAVLLVTHEPEEAMRMADEIALMRSGKIVQQGAPYNV
YTRPADRAAVGFFSDTNVLHAEVNGALAETPFGQFLAPGVPDGTKVDIVFRPQHLRIDFD
RNGRGPHPTPSDGVAARGVVKRARFLGHESLVEFCMDFDGSVLKATVPNVFLPDAGRVMW
LTVRRNRCFVFPTGS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory