Comparing GFF1057 FitnessBrowser__Marino:GFF1057 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
29% identity, 82% coverage: 87:480/480 of query aligns to 6:403/404 of 3wx9A
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
29% identity, 82% coverage: 87:480/480 of query aligns to 6:403/404 of 3av7A
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
29% identity, 82% coverage: 87:480/480 of query aligns to 6:403/404 of 3aowC
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
29% identity, 82% coverage: 87:480/480 of query aligns to 6:403/404 of 3aovA
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
27% identity, 77% coverage: 111:480/480 of query aligns to 27:401/403 of 1wstA
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
31% identity, 62% coverage: 171:469/480 of query aligns to 87:387/397 of 2zyjA
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
31% identity, 62% coverage: 171:469/480 of query aligns to 87:387/397 of Q72LL6
Sites not aligning to the query:
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
32% identity, 62% coverage: 171:469/480 of query aligns to 83:383/392 of 3cbfA
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
32% identity, 62% coverage: 171:469/480 of query aligns to 83:383/392 of 2egyA
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
32% identity, 62% coverage: 171:469/480 of query aligns to 79:379/389 of 2z1yA
Sites not aligning to the query:
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
26% identity, 75% coverage: 114:474/480 of query aligns to 35:403/405 of 2zc0A
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
25% identity, 76% coverage: 105:468/480 of query aligns to 32:406/420 of 1vp4A
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
31% identity, 62% coverage: 170:468/480 of query aligns to 79:383/388 of 8tn3A
5x03B Crystal structure of thE C-terminal domain of bacillus subtilis gabr reveals a closed conformation by the binding of gamma-aminobutyric acid, inducing the transcriptional activation (see paper)
29% identity, 59% coverage: 126:407/480 of query aligns to 13:292/365 of 5x03B
5t4kA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
28% identity, 59% coverage: 126:407/480 of query aligns to 14:293/360 of 5t4kA
Sites not aligning to the query:
5t4jB Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
28% identity, 59% coverage: 126:407/480 of query aligns to 14:293/360 of 5t4jB
Sites not aligning to the query:
6uxzB (S)-4-amino-5-phenoxypentanoate as a selective agonist of the transcription factor gabr (see paper)
28% identity, 59% coverage: 126:407/480 of query aligns to 13:292/358 of 6uxzB
Sites not aligning to the query:
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
24% identity, 89% coverage: 13:440/480 of query aligns to 10:423/458 of 7zlaB
Sites not aligning to the query:
7zn5B Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the closed conformation, c2 symmetry. (see paper)
24% identity, 89% coverage: 13:440/480 of query aligns to 7:400/435 of 7zn5B
Sites not aligning to the query:
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
24% identity, 66% coverage: 97:413/480 of query aligns to 16:360/428 of 4gebA
Sites not aligning to the query:
>GFF1057 FitnessBrowser__Marino:GFF1057
MKLRRRGRAMGILYNQVADQLQGLIHEGVYRDGERLPGVRQLSRQFGVSISTILQAHQTL
EARGFLQARERSGYFVRLPTVDAPEPVMRRHRSRPVPVSAREMALDLCADEQKRMVPLAT
AIPHPDYLPLRQIQHSTLWAARRGLETLDYAFPGKESFRRQIAQRMATLGVPVTPDDVLA
TNGAQEAIILALRAVTQPGDIVAVESPSFPGILQALEVVGLKVIEIPTHPSEGLSLEGLQ
LALEQWPLKACVVVTNHSNPMGAQMSDERKKQLVSMLAAAAVPLIEDDIYGDLHHTGDRP
KPAKAFDRADNVIYCSSFSKTISPGLRLGWMVPGRHMASARQHKYFVNLATSSIPQMAVA
HFLEQGGYDRYLRSARQHYREATERMRTAVARAFPEGTAVSRPQGGFVLWVQLPDGVSGT
EVYHRARAEDINVAPGLMFSTADKYDNCLRLNSANPWSERIEHAVARLGVLAHDVQSEAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory