SitesBLAST
Comparing GFF109 FitnessBrowser__Phaeo:GFF109 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6es9A Methylsuccinyl-coa dehydrogenase of paracoccus denitrificans with bound flavin adenine dinucleotide (see paper)
76% identity, 94% coverage: 36:560/561 of query aligns to 25:544/545 of 6es9A
- active site: F281 (= F296), T282 (= T297), A408 (= A424), R541 (= R557)
- binding coenzyme a: R75 (≠ Q84), F467 (= F483), W470 (= W486)
- binding flavin-adenine dinucleotide: Q50 (= Q59), A279 (= A294), F281 (= F296), T282 (= T297), G287 (= G302), S288 (= S303), W312 (= W328), I313 (= I329), T314 (= T330), E374 (= E390), R434 (= R450), Q436 (= Q452), F437 (= F453), L441 (= L457), F444 (= F460), Q502 (= Q518), I503 (= I519), G505 (= G521), G506 (= G522), F528 (= F544), A531 (= A547), E533 (= E549), I534 (= I550)
4iv6B X-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
40% identity, 69% coverage: 176:561/561 of query aligns to 2:377/383 of 4iv6B
- active site: L121 (≠ F296), T122 (= T297), G240 (≠ A424), E361 (= E545), K373 (≠ R557)
- binding dihydroflavine-adenine dinucleotide: L121 (≠ F296), T122 (= T297), G126 (≠ T301), G127 (= G302), S128 (= S303), W152 (= W328), I153 (= I329), S154 (≠ T330), R266 (= R450), S268 (≠ Q452), F269 (= F453), I273 (≠ L457), H276 (≠ F460), V279 (= V463), R334 (≠ Q518), V335 (≠ I519), G338 (= G522), L356 (≠ I540), G360 (≠ F544), T363 (≠ A547), E365 (= E549), I366 (= I550)
8ciwA Methylsuccinyl-coa dehydrogenase from pseudomonas migulae with bound fad and (2s)-methylsuccinyl-coa (see paper)
41% identity, 72% coverage: 157:560/561 of query aligns to 138:547/555 of 8ciwA
- binding flavin-adenine dinucleotide: I275 (≠ A294), I277 (≠ F296), T278 (= T297), G283 (= G302), S284 (= S303), W308 (= W328), T310 (= T330), R437 (= R450), V439 (≠ Q452), F440 (= F453), L444 (= L457), Q504 (= Q518), I505 (= I519), G508 (= G522), F530 (= F544), E535 (= E549), T536 (≠ I550)
- binding (2S)-Methylsuccinyl-CoA: R242 (= R261), S284 (= S303), V286 (≠ L305), H332 (= H351), Y370 (= Y385), F401 (= F414), Y402 (≠ K415), M405 (= M418), M408 (≠ F421), R412 (= R425), R418 (= R431), F530 (= F544), E531 (= E545), G532 (= G546), R544 (= R557)
Sites not aligning to the query:
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
35% identity, 69% coverage: 176:561/561 of query aligns to 5:378/379 of 1ukwB
- active site: L124 (≠ F296), S125 (≠ T297), T241 (≠ A424), E362 (= E545), R374 (= R557)
- binding cobalt (ii) ion: D145 (≠ N317), H146 (≠ D319)
- binding flavin-adenine dinucleotide: F122 (≠ A294), L124 (≠ F296), S125 (≠ T297), G130 (= G302), S131 (= S303), W155 (= W328), S157 (≠ T330), K200 (≠ G378), L357 (≠ I540), Y361 (≠ F544), E362 (= E545), T364 (≠ A547), E366 (= E549), L370 (≠ Q553)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
35% identity, 69% coverage: 176:561/561 of query aligns to 5:378/379 of 1ukwA
- active site: L124 (≠ F296), S125 (≠ T297), T241 (≠ A424), E362 (= E545), R374 (= R557)
- binding flavin-adenine dinucleotide: F122 (≠ A294), L124 (≠ F296), S125 (≠ T297), G130 (= G302), S131 (= S303), W155 (= W328), S157 (≠ T330), L357 (≠ I540), Y361 (≠ F544), E362 (= E545), T364 (≠ A547), E366 (= E549), L370 (≠ Q553)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
38% identity, 68% coverage: 178:560/561 of query aligns to 4:373/374 of 5lnxD
- active site: L122 (≠ F296), T123 (= T297), G239 (≠ A424), E358 (= E545), K370 (≠ R557)
- binding flavin-adenine dinucleotide: L122 (≠ F296), T123 (= T297), G128 (= G302), S129 (= S303), F153 (≠ W328), T155 (= T330), R265 (= R450), Q267 (= Q452), F268 (= F453), I272 (≠ L457), N275 (≠ F460), I278 (≠ V463), Q331 (= Q518), I332 (= I519), G335 (= G522), Y357 (≠ F544), T360 (≠ A547), E362 (= E549)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
37% identity, 68% coverage: 178:560/561 of query aligns to 6:377/378 of 5ol2F
- active site: L124 (≠ F296), T125 (= T297), G241 (≠ A424), G374 (≠ R557)
- binding calcium ion: E29 (≠ D201), E33 (≠ D206), R35 (≠ L208)
- binding coenzyme a persulfide: L238 (≠ F421), R242 (= R425), E362 (= E545), G363 (= G546)
- binding flavin-adenine dinucleotide: F122 (≠ A294), L124 (≠ F296), T125 (= T297), P127 (= P299), T131 (≠ S303), F155 (≠ W328), I156 (= I329), T157 (= T330), E198 (≠ I380), R267 (= R450), F270 (= F453), L274 (= L457), F277 (= F460), Q335 (= Q518), L336 (≠ I519), G338 (= G521), G339 (= G522), Y361 (≠ F544), T364 (≠ A547), E366 (= E549)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
35% identity, 68% coverage: 178:559/561 of query aligns to 8:378/378 of 4n5fA
- active site: L126 (≠ F296), T127 (= T297), G243 (≠ A424), E364 (= E545), R376 (= R557)
- binding dihydroflavine-adenine dinucleotide: L126 (≠ F296), T127 (= T297), G132 (= G302), S133 (= S303), F157 (≠ W328), T159 (= T330), T210 (≠ E390), Y363 (≠ F544), T366 (≠ A547), E368 (= E549), M372 (≠ Q553)
P41367 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; EC 1.3.8.7 from Sus scrofa (Pig) (see 2 papers)
35% identity, 68% coverage: 174:557/561 of query aligns to 35:413/421 of P41367
- 158:167 (vs. 294:303, 50% identical) binding in other chain
- S167 (= S303) binding
- WIT 191:193 (= WIT 328:330) binding in other chain
- S216 (≠ H351) binding
- D278 (≠ E422) binding
- R281 (= R425) binding
- RKT 306:308 (≠ RKQ 450:452) binding
- HQ 316:317 (≠ FP 460:461) binding in other chain
- R349 (= R493) binding
- T351 (≠ D495) binding
- QVFGG 374:378 (≠ QIHGG 518:522) binding
- E401 (= E545) active site, Proton acceptor; binding
- GTAQ 402:405 (≠ GAAE 546:549) binding in other chain
2a1tC Structure of the human mcad:etf e165betaa complex (see paper)
35% identity, 66% coverage: 188:557/561 of query aligns to 20:380/388 of 2a1tC
- active site: V127 (≠ F296), T128 (= T297), T247 (≠ A424), E368 (= E545), R380 (= R557)
- binding flavin-adenine dinucleotide: Y125 (≠ A294), V127 (≠ F296), T128 (= T297), G133 (= G302), S134 (= S303), Q155 (≠ N325), W158 (= W328), W158 (= W328), I159 (= I329), T160 (= T330), R273 (= R450), T275 (≠ Q452), F276 (= F453), L280 (= L457), H283 (≠ F460), I286 (≠ V463), Q341 (= Q518), I342 (= I519), G345 (= G522), I363 (= I540), T370 (≠ A547), Q372 (≠ E549)
3mdeA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
34% identity, 68% coverage: 176:557/561 of query aligns to 6:378/385 of 3mdeA
- active site: V125 (≠ F296), T126 (= T297), T245 (≠ A424), E366 (= E545), R378 (= R557)
- binding octanoyl-coenzyme a: T86 (≠ S257), E89 (≠ T260), L93 (≠ I264), S132 (= S303), V134 (≠ L305), S181 (≠ H351), F235 (= F414), M239 (= M418), F242 (= F421), R314 (= R493), Y365 (≠ F544), E366 (= E545), G367 (= G546)
- binding flavin-adenine dinucleotide: Y123 (≠ A294), V125 (≠ F296), T126 (= T297), G131 (= G302), S132 (= S303), W156 (= W328), I157 (= I329), T158 (= T330), R271 (= R450), T273 (≠ Q452), F274 (= F453), L278 (= L457), H281 (≠ F460), Q339 (= Q518), V340 (≠ I519), G343 (= G522), I361 (= I540), T368 (≠ A547), Q370 (≠ E549)
3mddA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
34% identity, 68% coverage: 176:557/561 of query aligns to 6:378/385 of 3mddA
- active site: V125 (≠ F296), T126 (= T297), T245 (≠ A424), E366 (= E545), R378 (= R557)
- binding flavin-adenine dinucleotide: Y123 (≠ A294), T126 (= T297), G131 (= G302), S132 (= S303), W156 (= W328), T158 (= T330), R271 (= R450), T273 (≠ Q452), F274 (= F453), H281 (≠ F460), Q339 (= Q518), V340 (≠ I519), G343 (= G522), I361 (= I540), T368 (≠ A547), Q370 (≠ E549)
1udyA Medium-chain acyl-coa dehydrogenase with 3-thiaoctanoyl-coa (see paper)
34% identity, 68% coverage: 176:557/561 of query aligns to 6:378/385 of 1udyA
- active site: V125 (≠ F296), T126 (= T297), T245 (≠ A424), E366 (= E545), R378 (= R557)
- binding 3-thiaoctanoyl-coenzyme a: L93 (≠ I264), Y123 (≠ A294), S132 (= S303), S181 (≠ H351), F235 (= F414), M239 (= M418), F242 (= F421), V249 (≠ T428), R314 (= R493), Y365 (≠ F544), E366 (= E545), G367 (= G546), I371 (= I550), I375 (≠ V554)
- binding flavin-adenine dinucleotide: Y123 (≠ A294), T126 (= T297), G131 (= G302), S132 (= S303), W156 (= W328), T158 (= T330), T273 (≠ Q452), F274 (= F453), Q339 (= Q518), V340 (≠ I519), G343 (= G522), T368 (≠ A547), Q370 (≠ E549)
P11310 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; Medium chain acyl-CoA dehydrogenase; MCADH; EC 1.3.8.7 from Homo sapiens (Human) (see 16 papers)
35% identity, 66% coverage: 188:557/561 of query aligns to 53:413/421 of P11310
- Y67 (≠ W202) to H: in ACADMD; mild; dbSNP:rs121434280
- L86 (≠ V222) mutation to M: Strongly reduced rate of electron transfer to ETF.
- L98 (≠ F234) mutation to W: Strongly reduced rate of electron transfer to ETF.
- L100 (= L236) mutation to Y: Strongly reduced rate of electron transfer to ETF.
- I108 (≠ V244) mutation to M: Strongly reduced rate of electron transfer to ETF.
- P132 (≠ L268) to R: in a breast cancer sample; somatic mutation; dbSNP:rs875989854
- 158:167 (vs. 294:303, 50% identical) binding in other chain
- S167 (= S303) binding
- W191 (= W328) mutation to A: Loss of electron transfer to ETF.; mutation to F: Reduces rate of electron transfer to ETF about six-fold.
- WIT 191:193 (= WIT 328:330) binding in other chain
- T193 (= T330) to A: in ACADMD; the thermostability is markedly decreased; dbSNP:rs121434279
- E237 (= E381) mutation to A: Strongly reduced rate of electron transfer to ETF.
- D278 (≠ E422) binding
- T280 (≠ A424) mutation to E: Narrower substrate specificity. Changed substrate specificity towards longer acyl chains; when associated with G-401. Loss of acyl-CoA dehydrogenase activity; when associated with T-410.
- R281 (= R425) binding ; to T: in ACADMD; mild clinical phenotype; dbSNP:rs121434282
- RKT 306:308 (≠ RKQ 450:452) binding
- HQ 316:317 (≠ FP 460:461) binding in other chain
- K329 (≠ E473) to E: in ACADMD; may alter splicing; decreased fatty acid beta-oxidation; dbSNP:rs77931234
- QILGG 374:378 (≠ QIHGG 518:522) binding
- E384 (= E528) mutation to A: Reduces rate of electron transfer to ETF three-fold.; mutation to Q: Reduces rate of electron transfer to ETF two-fold.
- E401 (= E545) active site, Proton acceptor; binding ; mutation to G: Changed substrate specificity towards longer acyl chains; when associated with E-280.; mutation to Q: Loss of acyl-CoA dehydrogenase activity.; mutation to T: Loss of acyl-CoA dehydrogenase activity; when associated with E-280.
- EGTSQ 401:405 (≠ EGAAE 545:549) binding in other chain
Q9H845 Complex I assembly factor ACAD9, mitochondrial; Acyl-CoA dehydrogenase family member 9; ACAD-9; EC 1.3.8.- from Homo sapiens (Human) (see 4 papers)
36% identity, 66% coverage: 189:556/561 of query aligns to 76:437/621 of Q9H845
- R193 (= R309) to W: in MC1DN20; uncertain significance; dbSNP:rs377547811
- S234 (≠ P346) to F: in MC1DN20; uncertain significance
- G303 (≠ A424) to S: in MC1DN20; uncertain significance; dbSNP:rs143383023
- A326 (= A447) to T: in MC1DN20; uncertain significance; dbSNP:rs115532916
- E413 (≠ S532) to K: in MC1DN20; uncertain significance; dbSNP:rs149753643
- E426 (= E545) mutation to Q: Loss of long-chain-acyl-CoA dehydrogenase activity. Does not affect mitochondrial complex I assembly.
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
8pheA Acad9-wt in complex with ecsit-cter (see paper)
37% identity, 62% coverage: 209:556/561 of query aligns to 56:400/551 of 8pheA
- binding : L143 (≠ F296), D151 (= D304), A153 (≠ G306), S154 (= S307), I155 (≠ L308), K202 (≠ H351), I205 (≠ L354), F256 (= F414), M260 (= M418), F295 (= F453), N296 (≠ G454), I394 (= I550), Y398 (≠ V554)
Sites not aligning to the query:
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
34% identity, 69% coverage: 176:560/561 of query aligns to 7:380/384 of 1jqiA
- active site: G377 (≠ R557)
- binding acetoacetyl-coenzyme a: L95 (≠ I264), F125 (≠ A294), S134 (= S303), F234 (= F414), M238 (= M418), Q239 (≠ E419), L241 (≠ F421), D242 (≠ E422), R245 (= R425), Y364 (≠ F544), E365 (= E545), G366 (= G546)
- binding flavin-adenine dinucleotide: F125 (≠ A294), L127 (≠ F296), S128 (≠ T297), G133 (= G302), S134 (= S303), W158 (= W328), T160 (= T330), R270 (= R450), F273 (= F453), L280 (≠ F460), Q338 (= Q518), I339 (= I519), G342 (= G522), I360 (= I540), T367 (≠ A547), E369 (= E549), I370 (= I550)
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
34% identity, 69% coverage: 176:560/561 of query aligns to 34:407/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
8phfA Cryo-em structure of human acad9-s191a (see paper)
36% identity, 62% coverage: 209:556/561 of query aligns to 56:400/547 of 8phfA
- binding flavin-adenine dinucleotide: T144 (= T297), W176 (= W328), K225 (≠ V382), R292 (= R450), Q294 (= Q452), F295 (= F453), F302 (= F460), L304 (≠ R462), I305 (≠ V463), I363 (= I519), G365 (= G521), G366 (= G522), F388 (= F544), E393 (= E549), M397 (≠ Q553)
Sites not aligning to the query:
1egcA Structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase complexed with octanoyl-coa (see paper)
35% identity, 66% coverage: 188:557/561 of query aligns to 19:379/387 of 1egcA
- active site: V126 (≠ F296), T127 (= T297), E246 (≠ A424), G367 (≠ E545), R379 (= R557)
- binding octanoyl-coenzyme a: E90 (≠ T260), L94 (≠ I264), Y124 (≠ A294), S133 (= S303), V135 (≠ L305), N182 (≠ H351), F236 (= F414), M240 (= M418), F243 (= F421), D244 (≠ E422), R247 (= R425), Y366 (≠ F544), G367 (≠ E545), G368 (= G546)
- binding flavin-adenine dinucleotide: Y124 (≠ A294), V126 (≠ F296), T127 (= T297), G132 (= G302), S133 (= S303), W157 (= W328), T159 (= T330), R272 (= R450), T274 (≠ Q452), F275 (= F453), L279 (= L457), H282 (≠ F460), I285 (≠ V463), Q340 (= Q518), I341 (= I519), G344 (= G522), I362 (= I540), I365 (= I543), Y366 (≠ F544), T369 (≠ A547), Q371 (≠ E549)
Query Sequence
>GFF109 FitnessBrowser__Phaeo:GFF109
MAHDGQDPQMQPTLISDVLTLTAAALEPVDQLLEAARATVREQVSEDGRVSGALVEAHQT
AAHGLAWLATYAYSLRQMHRWAAQLQADGKFGEMEQLMLQIGFGEYLWQIYGGIQMNQGE
ILRLQDLGLSQDSQRMLMAPAVMTLCDSGNTQAARLRLVELMQDQAGSVMFGASGLDEEL
EMIRDQFRRYALEKVEPNAHDWHLKDELIPMEIIEELAEMGVFGLTIPEEYGGFGLSKAS
MCVVSEELSRGYIGVGSLGTRSEIAAELIIAGGTEEQKASWLPKIASAEILPTAVFTEPN
TGSDLGSLRTRAVKDDNGDYQITGNKTWITHAARTHVMTLLARTDPDTTDHRGLSMFLAE
KTPGTDENPFPTEGMTGGEIEVLGYRGMKEYELGFDGFHVKRENLLGGDEGKGFKQLMET
FESARIQTAARAIGVAQSALDIAMQYAQDRKQFGKPLIAFPRVASKLAMMAVEIMIARQL
TYFSAWEKDNGHRCDLEAGMAKLLGARVAWAAADNGLQIHGGNGFALEYKISRVLCDARI
LNIFEGAAEIQAQVIARRLLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory