Comparing GFF1096 FitnessBrowser__WCS417:GFF1096 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vhaA Debp (see paper)
61% identity, 89% coverage: 29:301/308 of query aligns to 7:274/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
61% identity, 89% coverage: 29:301/308 of query aligns to 8:275/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
60% identity, 81% coverage: 29:276/308 of query aligns to 5:247/503 of 8ovoA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
33% identity, 77% coverage: 37:272/308 of query aligns to 4:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
33% identity, 77% coverage: 37:272/308 of query aligns to 4:223/225 of 4zv2A
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
32% identity, 69% coverage: 62:272/308 of query aligns to 38:234/243 of 5eyfB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
29% identity, 80% coverage: 29:273/308 of query aligns to 2:229/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
29% identity, 73% coverage: 49:272/308 of query aligns to 22:227/229 of 6svfA
Sites not aligning to the query:
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
30% identity, 79% coverage: 28:271/308 of query aligns to 1:229/231 of 2v25A
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
28% identity, 79% coverage: 29:270/308 of query aligns to 3:229/247 of 2yjpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
26% identity, 77% coverage: 37:274/308 of query aligns to 1:224/224 of 4ymxA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
25% identity, 80% coverage: 30:276/308 of query aligns to 1:235/237 of 4i62A
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
23% identity, 83% coverage: 24:278/308 of query aligns to 39:282/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
23% identity, 83% coverage: 24:278/308 of query aligns to 38:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
23% identity, 83% coverage: 24:278/308 of query aligns to 38:281/287 of 6h1uA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
24% identity, 79% coverage: 29:270/308 of query aligns to 6:232/251 of 1xt8B
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
25% identity, 79% coverage: 30:273/308 of query aligns to 4:232/240 of 4h5fA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
24% identity, 76% coverage: 38:272/308 of query aligns to 7:227/228 of 2y7iA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
27% identity, 57% coverage: 97:273/308 of query aligns to 48:211/217 of 2pyyB
Sites not aligning to the query:
7yfhB Structure of the rat glun1-glun2c nmda receptor in complex with glycine, glutamate and (r)-pyd-106 (see paper)
27% identity, 55% coverage: 105:272/308 of query aligns to 475:647/652 of 7yfhB
Sites not aligning to the query:
>GFF1096 FitnessBrowser__WCS417:GFF1096
MRIVPHILGAAIAAALISTPVFAAELTGTLKKINDSGTITLAHRDSSIPFSYIADGSGKP
VGYSHDIQLAVVEQLKKDLNKPDLKAKYNLVTSQTRIPLIQNGTADLECGSTTNNAERAQ
QVDFTVNIFEIGTRLLVKKDKDGKPSYADFADLKGKNVVTTAGTTSERIIKAMNADKQMG
MNVISAKDHGESFQMLESGRAVAFMMDDALLAGEEAKAKKPDDWVITGTPQSFEAYACMV
RKDDPAFKKAVDDAIVALYKSGEINKIYSKWFESPIPPKGLNLNFPMSDKVKELIANPSD
KPAPDVKI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory