SitesBLAST
Comparing GFF1103 FitnessBrowser__WCS417:GFF1103 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
47% identity, 98% coverage: 1:299/306 of query aligns to 5:310/315 of Q51742
- W22 (≠ V18) mutation to A: Decreased heat stability.
- E26 (≠ R22) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ E26) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ L30) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (≠ S217) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ T230) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E267) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
46% identity, 96% coverage: 1:295/306 of query aligns to 9:305/316 of Q81M99
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
46% identity, 96% coverage: 1:295/306 of query aligns to 5:301/307 of 4nf2A
- active site: R55 (= R55), T56 (= T56), R83 (= R83), R104 (= R104), H131 (= H131), Q134 (= Q134), D226 (= D219), C265 (= C259), R293 (= R287)
- binding phosphoric acid mono(formamide)ester: S53 (= S53), T54 (= T54), R55 (= R55), T56 (= T56), R104 (= R104), H131 (= H131), Q134 (= Q134), C265 (= C259), L266 (= L260), R293 (= R287)
- binding norvaline: L126 (= L126), N162 (= N162), D226 (= D219), S230 (= S223), M231 (= M224)
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
43% identity, 97% coverage: 4:299/306 of query aligns to 2:302/304 of 8qeuA
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
45% identity, 98% coverage: 4:302/306 of query aligns to 4:308/308 of 7nouA
- active site: R102 (= R104), H129 (= H131), Q132 (= Q134), D225 (= D219), C265 (= C259), R293 (= R287)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (= I48), T52 (= T54), R53 (= R55), R53 (= R55), F56 (≠ V58), F56 (≠ V58), L79 (= L81), D82 (≠ G84), E83 (= E85), V91 (= V93), Y95 (≠ M97), L266 (= L260), R293 (= R287)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
45% identity, 98% coverage: 4:302/306 of query aligns to 4:308/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
45% identity, 98% coverage: 4:302/306 of query aligns to 4:308/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
45% identity, 98% coverage: 4:302/306 of query aligns to 4:308/308 of 7nnyA
- active site: R102 (= R104), H129 (= H131), Q132 (= Q134), D225 (= D219), C265 (= C259), R293 (= R287)
- binding 1-naphthol: T52 (= T54), R53 (= R55), F56 (≠ V58), E83 (= E85), V91 (= V93), Y95 (≠ M97)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
45% identity, 98% coverage: 4:302/306 of query aligns to 4:308/308 of 7nnwA
- active site: R102 (= R104), H129 (= H131), Q132 (= Q134), D225 (= D219), C265 (= C259), R293 (= R287)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (= I48), T52 (= T54), R53 (= R55), F56 (≠ V58), L79 (= L81), L92 (≠ M94), Y95 (≠ M97)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
45% identity, 98% coverage: 4:302/306 of query aligns to 4:308/308 of 7nnvA
- active site: R102 (= R104), H129 (= H131), Q132 (= Q134), D225 (= D219), C265 (= C259), R293 (= R287)
- binding phosphoric acid mono(formamide)ester: S51 (= S53), T52 (= T54), R53 (= R55), T54 (= T56), R102 (= R104), H129 (= H131), C265 (= C259), L266 (= L260), R293 (= R287)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
45% identity, 98% coverage: 4:302/306 of query aligns to 3:307/307 of P9WIT9
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
45% identity, 98% coverage: 4:302/306 of query aligns to 3:307/307 of 2i6uA
- active site: R52 (= R55), T53 (= T56), R80 (= R83), R101 (= R104), H128 (= H131), Q131 (= Q134), D224 (= D219), C264 (= C259), R292 (= R287)
- binding phosphoric acid mono(formamide)ester: S50 (= S53), T51 (= T54), R52 (= R55), T53 (= T56), R101 (= R104), C264 (= C259), L265 (= L260), R292 (= R287)
- binding norvaline: L123 (= L126), N160 (= N162), D224 (= D219), S228 (= S223), M229 (= M224)
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
42% identity, 97% coverage: 4:299/306 of query aligns to 2:295/297 of 8qevA
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
42% identity, 94% coverage: 1:287/306 of query aligns to 37:330/354 of P00481
- R92 (= R55) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (= C259) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
42% identity, 94% coverage: 1:287/306 of query aligns to 37:330/354 of P00480
- G39 (≠ A3) to C: in OTCD; late onset; dbSNP:rs72554306
- R40 (= R4) to H: in OTCD; late onset; dbSNP:rs72554308
- L43 (= L7) to F: in dbSNP:rs72554309
- K46 (≠ M10) to R: in dbSNP:rs1800321
- Y55 (≠ S19) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (= L27) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (= K51) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 53:56) binding
- G100 (= G63) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ M64) to L: in dbSNP:rs1133135
- L111 (= L74) to P: in dbSNP:rs1800324
- T125 (≠ A88) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D89) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (≠ K92) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (≠ I103) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R104) binding ; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H131) binding
- Q171 (= Q134) binding
- I172 (≠ L135) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ M139) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TF 141:142) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ R146) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (= G151) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (= G158) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (= D159) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ C164) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (≠ A170) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (≠ I172) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (≠ F176) to K: in OTCD; late onset
- H214 (≠ Q177) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P183) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (= P188) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ V200) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (= T218) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (≠ V220) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W221) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G225) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (= Q226) to R: in dbSNP:rs1800328
- E272 (≠ D228) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (= R233) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H258) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (= C259) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (= CL 259:260) binding
- E309 (= E266) natural variant: Missing (in OTCD; late onset)
- R330 (= R287) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
- 333 natural variant: T -> A
- 340 S → P: in OTCD; late onset; dbSNP:rs72558489
- 343 T → K: in OTCD; late onset; dbSNP:rs72558491
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
41% identity, 94% coverage: 1:287/306 of query aligns to 4:297/321 of 1othA
- active site: R59 (= R55), T60 (= T56), V87 (≠ R83), R108 (= R104), H135 (= H131), Q138 (= Q134), D230 (= D219), C270 (= C259), R297 (= R287)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S53), T58 (= T54), R59 (= R55), T60 (= T56), R108 (= R104), L130 (= L126), H135 (= H131), N166 (= N162), D230 (= D219), S234 (= S223), M235 (= M224), C270 (= C259), L271 (= L260), R297 (= R287)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
41% identity, 94% coverage: 1:287/306 of query aligns to 4:297/321 of 1c9yA
- active site: R59 (= R55), T60 (= T56), V87 (≠ R83), R108 (= R104), H135 (= H131), Q138 (= Q134), D230 (= D219), C270 (= C259), R297 (= R287)
- binding phosphoric acid mono(formamide)ester: S57 (= S53), T58 (= T54), R59 (= R55), T60 (= T56), R108 (= R104), C270 (= C259), L271 (= L260), R297 (= R287)
- binding norvaline: L130 (= L126), N166 (= N162), D230 (= D219), S234 (= S223), M235 (= M224)
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
44% identity, 98% coverage: 4:302/306 of query aligns to 4:305/305 of 7np0A
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
44% identity, 97% coverage: 4:299/306 of query aligns to 4:299/302 of 7novA
- active site: R96 (= R104), H123 (= H131), Q126 (= Q134), D219 (= D219), C259 (= C259), R287 (= R287)
- binding (4-methyl-3-nitro-phenyl)-oxidanyl-oxidanylidene-boron: R53 (= R55), F56 (≠ V58), E77 (= E85), V85 (= V93), Y89 (≠ M97), L260 (= L260), A284 (= A284), R287 (= R287)
7nnzB Crystal structure of mycobacterium tuberculosis argf in complex with 5-methyl-4-phenylthiazol-2-amine.
44% identity, 97% coverage: 4:299/306 of query aligns to 3:294/297 of 7nnzB
Query Sequence
>GFF1103 FitnessBrowser__WCS417:GFF1103
MSARHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRVSF
EAGMIQLGGQAIFLSSRDTQLGRGEPIADSAKVMSSMLDAVMIRTFAHSTVTEFSANSRV
PVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRV
ACPEGYEPDARFLAQAGDRVTLVRDPRDAVIGAHLVSTDVWTSMGQEDETAKRLALFAPY
QVTRALLDLAAPDVLFMHCLPAHRGEEISTDLLDDPRSVAWDQAENRLHAQKALLEFLVP
PSYHHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory