SitesBLAST
Comparing GFF1118 FitnessBrowser__Marino:GFF1118 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
44% identity, 94% coverage: 5:227/237 of query aligns to 6:229/240 of 1ji0A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 95% coverage: 6:231/237 of query aligns to 3:232/233 of 6b8bA
- binding adenosine-5'-diphosphate: Y12 (= Y15), R15 (≠ S18), V17 (≠ I20), G38 (= G41), G40 (= G43), K41 (= K44), T42 (= T45), T43 (= T46)
- binding (3s,5s,7s)-N-{7-[(3-O-carbamoyl-6-deoxy-5-methyl-4-O-methyl-beta-D-gulopyranosyl)oxy]-4-hydroxy-8-methyl-2-oxo-2H-1-benzopyran-3-yl}tricyclo[3.3.1.1~3,7~]decane-1-carboxamide: F89 (= F92), R90 (≠ H93), R91 (≠ N94)
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 95% coverage: 6:231/237 of query aligns to 3:232/234 of 6b89A
- binding adenosine-5'-diphosphate: Y12 (= Y15), R15 (≠ S18), V17 (≠ I20), N37 (= N40), G38 (= G41), G40 (= G43), K41 (= K44), T42 (= T45), T43 (= T46)
- binding magnesium ion: T42 (= T45), Q84 (≠ E87)
- binding novobiocin: L71 (≠ T74), H72 (≠ W75), P83 (= P86), A86 (≠ R89), S87 (≠ G90), F89 (= F92), R90 (≠ H93), R91 (≠ N94), L92 (= L95), V101 (vs. gap), Q135 (≠ T136), R149 (= R150)
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 95% coverage: 6:231/237 of query aligns to 3:232/234 of 4p31A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 95% coverage: 6:231/237 of query aligns to 3:232/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 95% coverage: 6:231/237 of query aligns to 3:232/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (= Y15), R15 (≠ S18), N37 (= N40), G40 (= G43), K41 (= K44), T42 (= T45), T43 (= T46), Q84 (≠ E87), S136 (≠ E137), S138 (= S139), E141 (= E142)
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 95% coverage: 6:231/237 of query aligns to 3:232/235 of 6mhzA
- binding adp orthovanadate: Y12 (= Y15), N37 (= N40), G38 (= G41), G40 (= G43), K41 (= K44), T42 (= T45), T43 (= T46), Q84 (≠ E87), S136 (≠ E137), S138 (= S139), G139 (= G140), G140 (= G141), E162 (= E163), G166 (= G167), H194 (≠ K195)
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 97% coverage: 3:231/237 of query aligns to 1:233/241 of 6mbnA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 98% coverage: 4:235/237 of query aligns to 1:234/240 of 6mjpA
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
29% identity, 98% coverage: 4:235/237 of query aligns to 2:232/247 of P55339
- G164 (= G167) mutation to E: In ecsA-26; exoamylase and other exoenzymes decrease, competence- and sporulation-deficient phenotype.
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
29% identity, 94% coverage: 3:224/237 of query aligns to 2:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
29% identity, 94% coverage: 3:224/237 of query aligns to 2:228/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
29% identity, 93% coverage: 4:224/237 of query aligns to 1:226/253 of 6z5uK
- binding phosphoaminophosphonic acid-adenylate ester: R12 (≠ Y15), S37 (≠ N40), G38 (= G41), G40 (= G43), K41 (= K44), T42 (= T45), T43 (= T46), Q86 (≠ E87), E164 (= E163), H197 (≠ K195)
- binding magnesium ion: Q86 (≠ E87), E164 (= E163)
8fhkC Heterodimeric abc transporter bmrcd in the occluded conformation bound to atp: bmrcd_oc-atp (see paper)
33% identity, 87% coverage: 21:227/237 of query aligns to 352:560/574 of 8fhkC
Sites not aligning to the query:
7m33C The structure of bacillus subtilis bmrcd in the inward-facing conformation bound to hoechst-33342 and atp (see paper)
33% identity, 87% coverage: 21:227/237 of query aligns to 353:561/573 of 7m33C
Sites not aligning to the query:
8t1pC Heterodimeric abc transporter bmrcd in the occluded conformation bound to adpvi: bmrcd_oc-adpvi (see paper)
33% identity, 87% coverage: 21:227/237 of query aligns to 352:560/574 of 8t1pC
- binding adp orthovanadate: A472 (≠ E137), L473 (= L138), S474 (= S139), G475 (= G140), G476 (= G141), Q477 (≠ E142)
- binding adenosine-5'-triphosphate: T371 (≠ N40), G372 (= G41), S373 (≠ M42), G374 (= G43), K375 (= K44), T376 (= T45), T377 (= T46), Q417 (≠ E87), H529 (≠ K195)
- binding magnesium ion: T376 (= T45), Q417 (≠ E87)
Sites not aligning to the query:
O95477 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein; EC 7.6.2.1 from Homo sapiens (Human) (see 35 papers)
30% identity, 95% coverage: 6:230/237 of query aligns to 899:1124/2261 of O95477
- D917 (≠ H22) to Y: in a colorectal cancer sample; somatic mutation
- T929 (≠ M34) to I: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane
- N935 (= N40) to S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs28937313
- K939 (= K44) mutation to M: Inhibits ATPase activity; when associated with M-1952. Decreases translocase activity; when associated with M-1952. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-1952.
- S1042 (≠ A147) modified: Phosphoserine; by PKA
- P1065 (= P170) natural variant: P -> S
- M1091 (≠ I197) to T: in FHA1; loss of localization to plasma membrane; decreased cholesterol efflux; decreased phospholipid efflux
- C1110 (≠ H216) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1111.
- C1111 (≠ F217) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1110.
Sites not aligning to the query:
- 3 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased cholesterol efflux. Decreased phospholipid efflux. Decreased palmitoylation; when associated with S-23, S-1110 and S-1111.
- 23 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased palmitoylation; when associated with S-3, S-1110 and S-1111.
- 74 I→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.; I→K: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-371.
- 75 modified: Disulfide link with 309
- 85 P → L: in FHA1; Alabama; dbSNP:rs145183203
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 100 S→C: Highly decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 210 E → D: in a colorectal cancer sample; somatic mutation
- 219 R → K: in dbSNP:rs2230806
- 230 R → C: in dbSNP:rs9282541
- 244 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 248 P → A: in dbSNP:rs142625938
- 255 A → T: in TGD; deficient cellular cholesterol efflux; dbSNP:rs758100110
- 304 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-308.
- 308 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-304.
- 309 modified: Disulfide link with 75
- 364 S → C: in dbSNP:rs775035559
- 371 I→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane. 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-74 or C-375.; I→E: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-74.
- 375 L→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.
- 399 V → A: in dbSNP:rs9282543
- 401 K → Q: in dbSNP:rs138487227
- 496 R → W: in dbSNP:rs147675550
- 568 K→A: 60-65% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane.
- 573 Y→F: No effect on phospholipid and cholesterol efflux and on localization to cell membrane.
- 581 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-584 and K-585.
- 583 F→K: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-590.
- 584 E→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-585.
- 585 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-584.
- 590 W → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs137854496; W→E: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-583.
- 593 F→L: Moderately decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 638 R → Q: in dbSNP:rs374190304
- 771 V → M: in dbSNP:rs2066718
- 774 T → P: in dbSNP:rs35819696; natural variant: T -> S
- 776 K → N: in dbSNP:rs138880920
- 815 E → G: in dbSNP:rs145582736
- 825 V → I: in dbSNP:rs2066715
- 883 I → M: in dbSNP:rs2066714
- 1172 E → D: in dbSNP:rs33918808
- 1181 S → F: in dbSNP:rs76881554
- 1216 G → V: in dbSNP:rs562403512
- 1341 R → T: in dbSNP:rs147743782
- 1376 S → G: in dbSNP:rs145689805
- 1379 L → F: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1407 A → T: in a colorectal cancer sample; somatic mutation; dbSNP:rs189206655
- 1463 modified: Disulfide link with 1477
- 1477 modified: Disulfide link with 1463; C → R: in TGD; loss of interaction with APOE; unable to generate APOE-containing high density lipoproteins; moderately decreased protein abundance; moderately decreased ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs137854494
- 1512 T→M: Moderately decreased protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
- 1555 I → T: in dbSNP:rs1997618
- 1587 K → R: in dbSNP:rs2230808
- 1611 N → D: in FHA1; deficient cellular cholesterol efflux
- 1615 R → Q: in dbSNP:rs1251839800
- 1648 L → P: in dbSNP:rs1883024
- 1670 A → T: in dbSNP:rs1203589782
- 1680 R → Q: in dbSNP:rs150125857
- 1704 V → D: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1731 S → C: in dbSNP:rs760507032
- 1897 R → W: in FHA1; uncertain significance; dbSNP:rs760768125
- 1925 R → Q: in Scott syndrome; shows impaired trafficking of the mutant protein to the plasma membrane; dbSNP:rs142688906
- 1952 K→M: Inhibits ATPase activity; when associated with M-939. Decreases translocase activity; when associated with M-939. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-939.
- 2054 modified: Phosphoserine; by PKA
- 2081 R → W: in TGD; highly decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs137854501
- 2109 A → T: in a colorectal cancer sample; somatic mutation
- 2150 P → L: in FHA1; moderately decreased protein abundance; does not affect ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs369098049
- 2163 natural variant: F -> S
- 2168 L → P: in dbSNP:rs2853577
- 2243 D → E: in dbSNP:rs34879708
- 2244 V → I: in dbSNP:rs144588452
3d31A Modbc from methanosarcina acetivorans (see paper)
29% identity, 94% coverage: 5:226/237 of query aligns to 1:217/348 of 3d31A
Sites not aligning to the query:
Q8R420 Phospholipid-transporting ATPase ABCA3; ATP-binding cassette sub-family A member 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Mus musculus (Mouse) (see paper)
31% identity, 87% coverage: 21:226/237 of query aligns to 549:752/1704 of Q8R420
Sites not aligning to the query:
- 292 E→V: Knockin new born mice are healthy and survive into adulthood without overt signs of respiratory distress. Knockin mice show a severe lung phenotype that begins with alveolar inflammatory cell infiltration at the early stage of the mouse life followed by aberrant lung remodeling with characteristics of diffuse parenchymal lung disease (DPLD)- and emphysema-like alveolar disruption in older mice.
7tbwA The structure of atp-bound abca1 (see paper)
30% identity, 95% coverage: 6:230/237 of query aligns to 754:979/1928 of 7tbwA
- binding adenosine-5'-triphosphate: Y763 (= Y15), D765 (vs. gap), K768 (≠ S18), N790 (= N40), G791 (= G41), G793 (= G43), K794 (= K44), T795 (= T45), Q835 (≠ E87), Q887 (≠ E137), S889 (= S139), H944 (≠ K195)
- binding magnesium ion: Q835 (≠ E87), D912 (= D162), Q913 (≠ E163)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 1630, 1633, 1657, 1658, 1660, 1661, 1662, 1663, 1702, 1753, 1755, 1756, 1757, 1779, 1783, 1811
- binding cholesterol: 218, 219, 360, 367
- binding magnesium ion: 1662, 1702
Query Sequence
>GFF1118 FitnessBrowser__Marino:GFF1118
MRNSLLEVKNLNTLYGRSHILHDLSFRLGKGQSMSLMGRNGMGKTTTLKSILGIVPPRSG
HVHFDGEDISKLPTWKRMRRDIAYVPEGRGIFHNLTVKEHLQMAARPDSNGKTSWDFERV
MDTFPRLQERLSNLGTELSGGEQQMLAIGRALVTNPRLMILDEATEGLAPLIRADIWKVI
ATIRESGISTLVVDKNIKALKKLCDYHVVIVKGKIHFDGSSKELDENLETVETALSV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory