Comparing GFF1119 FitnessBrowser__Marino:GFF1119 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 95% coverage: 6:248/255 of query aligns to 4:254/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 95% coverage: 6:247/255 of query aligns to 4:253/253 of 1g9xB
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
27% identity, 98% coverage: 4:253/255 of query aligns to 2:245/501 of P04983
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
29% identity, 86% coverage: 6:224/255 of query aligns to 1:213/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
30% identity, 90% coverage: 6:234/255 of query aligns to 1:222/222 of P0A9R7
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 87% coverage: 14:235/255 of query aligns to 9:223/240 of 4ymuJ
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
29% identity, 86% coverage: 6:224/255 of query aligns to 1:213/218 of 8hd0A
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
27% identity, 97% coverage: 1:247/255 of query aligns to 1:238/240 of 1ji0A
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
29% identity, 83% coverage: 20:231/255 of query aligns to 21:221/265 of 4hluA
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 93% coverage: 6:243/255 of query aligns to 2:229/241 of 4u00A
5x40A Structure of a cbio dimer bound with amppcp (see paper)
30% identity, 91% coverage: 6:238/255 of query aligns to 4:230/280 of 5x40A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
29% identity, 92% coverage: 4:237/255 of query aligns to 2:225/285 of 4yerA
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
27% identity, 93% coverage: 7:243/255 of query aligns to 4:237/262 of 7chaI
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 96% coverage: 6:249/255 of query aligns to 2:237/240 of 6mjpA
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
28% identity, 91% coverage: 6:236/255 of query aligns to 2:227/253 of 6z5uK
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
30% identity, 83% coverage: 20:231/255 of query aligns to 21:219/263 of 4zirA
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
28% identity, 91% coverage: 6:236/255 of query aligns to 4:229/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
28% identity, 91% coverage: 6:236/255 of query aligns to 4:229/263 of 7d08B
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
26% identity, 92% coverage: 5:238/255 of query aligns to 4:231/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
26% identity, 92% coverage: 5:238/255 of query aligns to 4:231/353 of 1oxvA
>GFF1119 FitnessBrowser__Marino:GFF1119
MANEIILETESLSKHWGGIKALDDISLQFQDKHLHGVVGPNGAGKSTLLNMLCGTLKPTS
GCIFHKGDQIEGMKPWEFVHRGIGRSFQKTNIYVDVTCLENCAIAAQRRFTGSFNLFASR
HSNKLVREGAEKALCQVGLENRVHTVAAEISYGEQRQLELAMVLATDPCILLLDEPMAGM
GHEESQRIIELMNQLKQTYSIVLVEHDMDAIFELSDQLTVLDNGTHLITGTVDEVRNDTR
VKEAYLGKEKEEEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory