SitesBLAST
Comparing GFF1128 FitnessBrowser__Marino:GFF1128 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O85673 Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see 2 papers)
45% identity, 99% coverage: 1:410/414 of query aligns to 43:457/471 of O85673
- M43 (= M1) mutation to K: Prevents anthranilate degradation.
- D217 (= D177) mutation to A: In ACN476; loss of dioxygenase activity and 2-fold lower redox potential.; mutation to E: Loss of dioxygenase activity and lack of iron at the mononuclear site.; mutation to N: Loss of dioxygenase activity.
2b24A Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. Bound to indole (see paper)
30% identity, 81% coverage: 4:338/414 of query aligns to 41:378/440 of 2b24A
- active site: H111 (= H74), D213 (= D177), H216 (= H180), H221 (= H185), D372 (= D332)
- binding fe (iii) ion: H216 (= H180), H221 (= H185), D372 (= D332)
- binding fe2/s2 (inorganic) cluster: C88 (= C51), H90 (= H53), R91 (= R54), C108 (= C71), Y110 (≠ F73), H111 (= H74), W113 (= W76)
- binding indole: D213 (= D177), H295 (≠ L267), F307 (= F274)
2b1xA Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. (see paper)
30% identity, 81% coverage: 4:338/414 of query aligns to 41:378/441 of 2b1xA
- active site: H111 (= H74), D213 (= D177), H216 (= H180), H221 (= H185), D372 (= D332)
- binding fe (iii) ion: H216 (= H180), H221 (= H185), D372 (= D332)
- binding fe2/s2 (inorganic) cluster: C88 (= C51), H90 (= H53), R91 (= R54), C108 (= C71), Y110 (≠ F73), H111 (= H74), W113 (= W76)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
26% identity, 84% coverage: 1:348/414 of query aligns to 32:376/424 of 3en1A
- active site: H105 (= H74), D205 (= D177), H208 (= H180), H214 (≠ W186), D360 (= D332)
- binding fe (ii) ion: Q201 (≠ N174), H208 (= H180), H214 (≠ W186), D360 (= D332)
- binding fe2/s2 (inorganic) cluster: C82 (= C51), H84 (= H53), R85 (= R54), C102 (= C71), Y104 (≠ F73), H105 (= H74), W107 (= W76)
- binding toluene: Q201 (≠ N174), F202 (≠ G175), D205 (= D177), H208 (= H180), H295 (≠ N266)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
28% identity, 84% coverage: 1:348/414 of query aligns to 48:394/460 of Q53122
- C98 (= C51) binding
- H100 (= H53) binding
- C118 (= C71) binding
- H121 (= H74) binding
- 217:230 (vs. 174:185, 29% identical) binding
- H224 (= H180) binding
- H230 (= H185) binding
- D378 (= D332) binding
2gbxA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
28% identity, 82% coverage: 1:339/414 of query aligns to 25:362/449 of 2gbxA
- active site: H98 (= H74), D199 (= D177), H202 (= H180), H207 (= H185), D355 (= D332)
- binding biphenyl: D199 (= D177), V203 (= V181), L255 (= L229), H288 (≠ N263), N290 (= N266), L300 (≠ M276)
- binding fe (iii) ion: H202 (= H180), H207 (= H185), D355 (= D332)
- binding fe2/s2 (inorganic) cluster: C75 (= C51), H77 (= H53), R78 (= R54), C95 (= C71), Y97 (≠ F73), H98 (= H74), W100 (= W76)
2gbwA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 (see paper)
28% identity, 82% coverage: 1:339/414 of query aligns to 25:362/449 of 2gbwA
- active site: H98 (= H74), D199 (= D177), H202 (= H180), H207 (= H185), D355 (= D332)
- binding fe (iii) ion: H202 (= H180), H207 (= H185), D355 (= D332)
- binding fe2/s2 (inorganic) cluster: C75 (= C51), H77 (= H53), R78 (= R54), C95 (= C71), Y97 (≠ F73), H98 (= H74), W100 (= W76)
- binding oxygen molecule: H202 (= H180), F345 (= F322), D355 (= D332)
7ylsB Structure of a bacteria protein complex
26% identity, 86% coverage: 2:355/414 of query aligns to 35:399/436 of 7ylsB
8h2tB Cryo-em structure of iadd/e dioxygenase bound with iaa (see paper)
26% identity, 86% coverage: 2:355/414 of query aligns to 34:398/435 of 8h2tB
- binding fe (iii) ion: N208 (= N174), H214 (= H180), H219 (= H185), D375 (= D332)
- binding fe2/s2 (inorganic) cluster: C83 (= C51), H85 (= H53), K86 (≠ R54), C104 (= C71), H107 (= H74), W109 (= W76)
- binding 1h-indol-3-ylacetic acid: N208 (= N174), L209 (≠ G175), D211 (= D177), H214 (= H180), P215 (≠ V181), F249 (vs. gap), K320 (≠ M276), Y360 (= Y318)
4hm8A Naphthalene 1,2-dioxygenase bound to thioanisole
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 4hm8A
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding (methylsulfanyl)benzene: N201 (= N174), H295 (≠ N263)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
4hm7A Naphthalene 1,2-dioxygenase bound to styrene
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 4hm7A
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
- binding ethenylbenzene: N201 (= N174), H208 (= H180), H295 (≠ N263), N297 (= N266)
4hm6A Naphthalene 1,2-dioxygenase bound to phenetole
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 4hm6A
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding ethoxybenzene: N201 (= N174), H208 (= H180), H295 (≠ N263)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
4hm4A Naphthalene 1,2-dioxygenase bound to indan
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 4hm4A
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding 2,3-dihydro-1H-indene: H208 (= H180), H295 (≠ N263), N297 (= N266)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
4hm3A Naphthalene 1,2-dioxygenase bound to ethylbenzene
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 4hm3A
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
- binding phenylethane: N201 (= N174), D205 (= D177), H208 (= H180), N297 (= N266)
4hm2A Naphthalene 1,2-dioxygenase bound to ethylphenylsulfide
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 4hm2A
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding (ethylsulfanyl)benzene: N201 (= N174), D205 (= D177), V209 (= V181), H295 (≠ N263), N297 (= N266)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
4hm1A Naphthalene 1,2-dioxygenase bound to 1-indanone
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 4hm1A
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding 2,3-dihydro-1H-inden-1-one: N201 (= N174), V209 (= V181), N297 (= N266)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
4hkvA Naphthalene 1,2-dioxygenase bound to benzamide
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 4hkvA
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
- binding benzamide: N201 (= N174), H208 (= H180), H295 (≠ N263), N297 (= N266)
4hjlA Naphthalene 1,2-dioxygenase bound to 1-chloronaphthalene
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 4hjlA
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding 1-chloronaphthalene: N201 (= N174), D205 (= D177), H208 (= H180), H295 (≠ N263), N297 (= N266), L307 (≠ M276)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
2hmoA Crystal structure of naphthalene 1,2-dioxygenase bound to 3- nitrotoluene. (see paper)
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 2hmoA
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding 3-nitrotoluene: N201 (= N174), N297 (= N266), W358 (≠ A328)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
2hmmA Crystal structure of naphthalene 1,2-dioxygenase bound to anthracene (see paper)
29% identity, 80% coverage: 1:332/414 of query aligns to 31:362/446 of 2hmmA
- active site: H104 (= H74), D205 (= D177), H208 (= H180), H213 (= H185), D362 (= D332)
- binding anthracene: N201 (= N174), D205 (= D177), H208 (= H180), V209 (= V181), F224 (≠ S200), N297 (= N266)
- binding fe (iii) ion: H208 (= H180), H213 (= H185), D362 (= D332)
- binding fe2/s2 (inorganic) cluster: C81 (= C51), H83 (= H53), R84 (= R54), C101 (= C71), Y103 (≠ F73), H104 (= H74), W106 (= W76)
Query Sequence
>GFF1128 FitnessBrowser__Marino:GFF1128
MKYIFEGNWVYLAHESQIQENNDFFTTYIGRHPIIITRDKSGNLNAFLNICTHRGAMLCR
SKKGNKSVMTCPFHGWSFNNSGKLVKVKDEKGSGYPDSFNCEGELNLKNIAKFDSYRGFL
FGSLNSDVQDLNDYLGDTTKIIDMIVDQSEDEIEVLRGASTYTFDGNWKVQAENGVDGYH
VSAVHWNYVATVARRKQGLSEDSAKSVDLSSWNKQKGGSYAFKNGHTLLWMEAPNPQDRP
LAEKREELSRKYGKNRADWMISNIRNLGIYPNVFLMDQTSTQIRHFRPISVNKTEVTIYC
FAPKNESGEARNRRIRQYEDFFNATGMATPDDLEQFNSSQISFHASKAPWNDLSRGAKHW
IDGQDKEAESIDIFPLLSGVKSEDEGLFVMQHECWANALLRGMSDEEDKVICKE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory