Comparing GFF1142 FitnessBrowser__Phaeo:GFF1142 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i6vA Crystal structure of a periplasmic his/glu/gln/arg/opine family- binding protein from silicibacter pomeroyi in complex with lysine
68% identity, 89% coverage: 22:230/236 of query aligns to 1:210/218 of 3i6vA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
30% identity, 89% coverage: 22:230/236 of query aligns to 4:248/259 of 5ovzA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
30% identity, 89% coverage: 22:230/236 of query aligns to 3:247/256 of 5otcA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
30% identity, 89% coverage: 22:230/236 of query aligns to 3:247/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
30% identity, 89% coverage: 22:230/236 of query aligns to 3:247/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
30% identity, 89% coverage: 22:230/236 of query aligns to 3:247/254 of 4powA
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
30% identity, 89% coverage: 22:230/236 of query aligns to 4:248/255 of 5itoA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
32% identity, 90% coverage: 19:230/236 of query aligns to 2:222/225 of 4zv2A
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
30% identity, 97% coverage: 3:230/236 of query aligns to 9:252/260 of P02911
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
32% identity, 90% coverage: 19:230/236 of query aligns to 2:224/226 of 4zv1A
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
29% identity, 90% coverage: 18:230/236 of query aligns to 1:230/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
29% identity, 90% coverage: 18:230/236 of query aligns to 1:230/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
29% identity, 90% coverage: 18:230/236 of query aligns to 1:230/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
29% identity, 90% coverage: 18:230/236 of query aligns to 1:230/238 of 1lafE
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
29% identity, 89% coverage: 22:230/236 of query aligns to 2:227/235 of 5owfA
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
31% identity, 90% coverage: 18:230/236 of query aligns to 1:230/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
30% identity, 90% coverage: 19:230/236 of query aligns to 24:252/260 of P02910
Sites not aligning to the query:
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
31% identity, 90% coverage: 19:230/236 of query aligns to 24:252/260 of P0AEU0
Sites not aligning to the query:
5orgA Structure of the periplasmic binding protein (pbp) occj from a. Tumefaciens b6 in complex with octopine. (see paper)
27% identity, 89% coverage: 22:230/236 of query aligns to 5:249/257 of 5orgA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
31% identity, 89% coverage: 22:230/236 of query aligns to 11:227/229 of 5t0wA
>GFF1142 FitnessBrowser__Phaeo:GFF1142
MKSLILGTAALALTAGIAMADTVRLGTEGAYPPYNFLNDDGQVDGFERELGDELCKRAEL
DCEWVTNDWDSIIPNLLSGNYDTIIAGMSITAERKEVVNFTTGYTRPSPSAYAAMSADVD
VNSAVVAAQASTIQAAHVASTGATLVEFPTPDETVAAVKAGEVDAVMADKDFLIPIVGET
EMEFVADDVLLGDGIGMAFRKSDDELRGKFDVAIESMKADGSLNALLEKWEIEGQF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory